KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0086Help
Entry
SAK_0086          CDS       T00278                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAK_0086
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAK_0086
   00620 Pyruvate metabolism
    SAK_0086
   00650 Butanoate metabolism
    SAK_0086
  Lipid metabolism
   00071 Fatty acid degradation
    SAK_0086
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAK_0086
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAK_0086
   00626 Naphthalene degradation
    SAK_0086
Enzymes [BR:sak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAK_0086
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SAK_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
68961..71603
Genome map
AA seq 880 aa AA seqDB search
MTEKTKAVETTDVALAIDTLVQNGLKALDEMRQLNQEQVDYIVAKASVAALDAHGELALH
AVEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQWIEQ
PSIDATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYKEFVEEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKSAVWIAEQAGFTVPEGTNILAAECTEVSEKEPLTREKLSPVIAV
LKAESTEDGVEKARQMVEFNGLGHSAAIHTKDADLAREFGTRIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFAEVEPDPDITTVMKG
TDLMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVMTVPGFIAA
DTGMDVLTHATEAYVSQMANDYTDGLALQAIKIVFDYLERSVKDADFEAREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPAATPEEAVESYAKAVYDLGTRLGIKMNFRDQGIDEKEWKEKSRELA
FLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYEERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaactaaagcagtagaaactacagatgttgctcttgcaattgatacattg
gttcaaaatggtttaaaagcacttgatgagatgcgtcaacttaatcaagaacaagttgat
tatattgtagctaaagcttctgttgcagccttggatgcccatggagaacttgctcttcat
gcagtagaggaaactggtcgtggtgtctttgaagataaagcgacaaaaaatttatttgca
tgtgaacacgtcgttaacaacatgcgtcatacaaagacagtgggagttattgaagaagac
gatgtcacaggcttgacattaattgctgaaccagtgggagttgtctgtggtattacgcca
acaaccaacccgacttcaactgctattttcaagtcattaatctctcttaaaacacgtaat
ccaattatttttgccttccacccatcagcacaagaatcatcagcacatgcagcacgtatt
gttcgtgatgctgctatcgctgctggagctcctgaaaattgtgtccaatggattgaacaa
ccatcgattgatgcaactaatgctttgatgaaccatgatggtattgccactatccttgcg
acaggtggtaatgcgatggttaaagctgcctactcatgtgggaaacctgcccttggtgta
ggtgctgggaatgttccagcttatgttgaaaaatcagctaatatccgacaagccgctcac
gatattgttatgtctaaatcatttgataacggtatggtatgtgcatcagaacaggctgtt
attattgataaagaaatttataaagaatttgttgaagaatttaaatcttatcatacctat
ttcgttaataagaaagaaaaagctcttcttgaagaattctgttttggtgcaaaagcaaat
agcaaaaactgtgctggtgcaaaattaaatccaaatattgttggaaaatcagcagtttgg
attgctgaacaagctggatttactgttccagaaggaacaaatattcttgccgcagaatgt
actgaagttagtgaaaaagaacctttgacacgtgaaaaactatcacctgttattgcagta
ttgaaagctgaatctacagaagatggtgttgaaaaagctcgtcaaatggttgagtttaat
ggtctagggcactcagctgctattcatacaaaagatgcagacttagctcgtgaatttgga
actagaattcgtgctatccgtgttatttggaattctccttctacttttggtggtattggg
gatgtttacaatgctttcttgccatcattgactcttggttgtggttcgtatggacgtaac
tcagttggtgataacgttagtgctataaatctcttgaatatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagtcccttcaaaaacatacttcgaacgtgattctatt
caatatttgcaaaaatgtcgcgatgttgaacgtgtcatgattgttacagatcacgccatg
gttgagcttggtttcttggatcgtatcattgaacaacttgatcttcgtcgcaataaagtt
gtttatcagatttttgctgaagtagaaccagatccagacattacaacagtaatgaaagga
acagatttgatgcgtaccttcaaaccagacactattattgcattaggtggtggttctcct
atggatgctgcgaaagttatgtggctcttctatgaacaaccagaagttgatttccatgac
ctcgttcaaaaattcatggatatccgtaaacgtgcgttcaaattcccagaacttggtaag
aaaacaaaatttgttgctattccaacaacttctggaacaggttctgaagtgacaccattt
gccgttatctctgacaaagcaaataatcgtaaatatccaatcgctgattattcattaaca
ccaactgtagctatcgttgatccggcccttgttatgactgttcctggttttattgcggct
gatacgggtatggatgtattgacacatgcaacagaggcttatgtttcacagatggcaaat
gattatacagacggacttgctcttcaagcaattaaaattgtgtttgactacttagaacgc
tcagtaaaagatgctgattttgaagcacgtgaaaagatgcacaatgcgtcaactatggca
ggtatggctttcgccaatgcattcttaggtatttctcactcaatggcgcataaaattggc
gcacaattccataccgtacacggacgtacaaatgcaattcttttgccgtatgttatccgc
tataatggaactcgtccagctaaaacagcaacatggcctaagtacaattactatcgtgct
gatgaaaagtatcaagatatcgctaaattactcggcttaccagcagcaacaccagaagaa
gctgtcgaatcatatgcaaaagctgtgtatgaccttggaacacgtttaggtattaagatg
aatttccgtgaccaaggcattgatgaaaaagaatggaaagaaaaatctcgtgaactagct
ttcttagcatatgaagatcaatgttcaccagcaaatccacgccttccaatggtagatcac
atgcaagaaatcatcgaagatgcttattatggttatgaggaacgtccaggacgccgtaag
taa

DBGET integrated database retrieval system