KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0087Help
Entry
SAK_0087          CDS       T00278                                 

Gene name
adhA
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAK_0087 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAK_0087 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    SAK_0087 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAK_0087 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAK_0087 (adhA)
   00626 Naphthalene degradation
    SAK_0087 (adhA)
Enzymes [BR:sak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAK_0087 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
71782..72798
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQASTGVEVVEHDLPKVGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEEIGEGVTSLRVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIAVYGAGGLGNLAVQ
YAKKVFNAHVVAVDINADKLQLAKEVGADLTVNGKEIKDVAAYIQEKTGGCHGVVVTAVS
KIAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIRVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVDTAPQVFDEMERGLIQGRKVLDFTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggttgttgttaatcaagctagtacaggtgttgaagttgttgagcatgatctt
ccaaaagttggtcatggtgaagcacttgtaaaagtagaatactgtggtgtgtgccatact
gatttacacgttgcacatggagatttcggccaggtaccaggacgcattttgggtcacgaa
ggcattggtatagtagaagaaattggagaaggcgtaacgtctttgagggttggtgatcgt
gtctctattgcatggttctttgaaggatgcggtcattgcgaatactgtactacaggacgt
gagacgctttgtcgtagtgttaaaaatgctggatacagtgttgatggtggtatgagtgaa
tacgctattgttaccgcggactatgcggttaaggttcctgagggattagatccagctcaa
gcatcatcaatcacttgtgctggagtaacaacatacaaggctatcaaagaagctggagct
gctcctggtcagtggattgcagtgtatggtgcaggtggtcttggaaacttagcagtccag
tatgcaaaaaaagtattcaatgctcatgttgtagctgttgatattaacgcagataaactt
caattagctaaagaggttggagcagatttgacagttaatggcaaagaaataaaagatgtt
gcggcctatattcaagaaaagacaggcggttgtcatggagtggttgtgactgctgtttct
aaaattgcgtttaatcaggcgattgacagcgttcgtgctggaggtacagtggtagctgtt
ggtcttccatcagaatatatggaattgagtattgtaaaaacagtacttgatgggattcgt
gtggttggttccttagttggaactcgtaaagatttagaagaagccttcgcatttggagca
gaaggcttggtagtaccggtggttgaaaaagtgcctgtggatacagctcctcaagtattc
gatgaaatggaaagaggattgattcaagggcgtaaagttcttgactttacaaagtga

DBGET integrated database retrieval system