KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0216Help
Entry
SAK_0216          CDS       T00278                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sak00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
180308..181159
Genome map
AA seq 283 aa AA seqDB search
MKIFEKAPAKLNLGLDIKGRCDDGYHELAMIMVSIDLNDYVTISELKEDCIVIDSDSSKM
PLNNDNDVFKAADIIKNQYGINKGVHIRLEKSIPVCAGLGGGSTDAAATIRALNRLWNLQ
MDYDEMVAIGFKIGSDVPYCLGGGCSLVLGKGEIVKPLPTLRPCWIVLVKPDFGISTKSI
FRDIDCKSISRVDIDLLKSAILSSDYQLMVKSMGNSLEDITITKNPVISTIKERMLNSGA
DVALMTGSGPTVFSMCSTEKKADRVFNSMKGFCKEVYKVRLLR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttttgagaaagctcctgccaaacttaatttaggattagatattaaaggacga
tgtgacgatggttatcatgaattagctatgattatggttagtattgatcttaatgactac
gttaccatttctgagctaaaggaagattgtattgttatcgattctgatagtagcaaaatg
cctttaaataatgataatgatgtgtttaaagctgcagatataatcaaaaatcaatatggt
attaataaaggtgttcatattagattagaaaaatccattcctgtctgtgcaggactgggg
ggtggttctactgatgctgctgctacaataagagctcttaatcgattatggaatcttcaa
atggactatgacgaaatggttgctattggttttaaaattggtagtgatgttccttattgt
cttggtgggggatgttcgttagtattaggtaaaggtgaaattgttaaacccttaccgaca
ttgagaccatgttggatagttctggttaagccggattttggtatttcaactaaatccatt
tttagagatattgattgtaagtctataagtagagttgatattgatttattaaagtctgct
attttgtcatcagattatcagttaatggtcaaatctatgggaaattcactcgaggatatt
acaattactaaaaatccagttataagtacaataaaagaacgtatgttaaattctggagcc
gatgttgcattaatgacaggaagtggaccaactgttttttcaatgtgttctacagagaaa
aaagctgatcgtgtttttaatagtatgaaaggtttttgcaaagaagtttataaagttagg
ttgttgagataa

DBGET integrated database retrieval system