KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0479Help
Entry
SAK_0479          CDS       T00278                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00040  Pentose and glucuronate interconversions
sak00052  Galactose metabolism
sak00500  Starch and sucrose metabolism
sak00520  Amino sugar and nucleotide sugar metabolism
sak01100  Metabolic pathways
sak01130  Biosynthesis of antibiotics
Module
sak_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SAK_0479 (galU)
   00052 Galactose metabolism
    SAK_0479 (galU)
   00500 Starch and sucrose metabolism
    SAK_0479 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SAK_0479 (galU)
Enzymes [BR:sak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SAK_0479 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABA46292
Position
complement(423350..424249)
Genome map
AA seq 299 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSK
RSIEDHFDSNFELEYNLKEKGKNELLKLVDETTGIRLHFIRQSHPRGLGDAVLQAKAFVG
NEPFVVMLGDDLMDITNNKVIPLTKQLINDFEATHASTIAVMEVPHEDVSAYGVIAPQGE
GVNGLYSVNTFVEKPSPEEAPSNLAIIGRYLLTPEIFNILETQKPGAGNEIQLTDAIDTL
NKTQRVFARKFTGDRYDVGDKFGFMKTSIDYALQHPQVKDDLKKYIIDLGKSLEKTSKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagaaaagcagttatccctgccgctggtttaggaacacgttttttacctgct
actaaagctttagctaaagaaatgcttccaatcgttgataaaccaactattcaatttatt
gttgaagaagcactaaaatctggaattgaagatattttagttgtaactggtaaatcaaaa
cgttctatagaagaccactttgattcaaattttgaattagaatataacctaaaagagaaa
gggaaaaacgaacttctcaaacttgttgatgaaacaactggcattcgactccattttatt
cgacaaagtcatcctcgtgggcttggagatgctgtgctacaagcaaaagccttcgttggt
aatgaaccttttgttgttatgctaggtgatgatctaatggatattaccaataataaagtt
attcctctcaccaaacaattaattaatgactttgaagctactcatgcatcaacaattgct
gttatggaagttccacatgaagatgtttctgcttacggtgttatcgctccacaaggagaa
ggagttaatggtctatatagcgttaacactttcgttgaaaaaccttctcccgaagaggct
ccaagtaatttggcaatcattggtcgctacttgttaactccagaaatttttaatatttta
gaaactcaaaaacctggtgcaggaaatgaaattcaactaaccgatgctatcgatacttta
aataaaacgcaacgtgtttttgctagaaaatttacaggagaccgttatgacgttggtgat
aagtttggttttatgaaaacatctattgattatgctcttcaacacccacaagttaaagat
gacttgaagaaatatatcattgatttaggaaaatctctagaaaaaacatctaagaagtaa

DBGET integrated database retrieval system