KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0535Help
Entry
SAK_0535          CDS       T00278                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SAK_0535
  Lipid metabolism
   00561 Glycerolipid metabolism
    SAK_0535
   00600 Sphingolipid metabolism
    SAK_0535
Enzymes [BR:sak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SAK_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
477087..479288
Genome map
AA seq 733 aa AA seqDB search
MPINFREKEKEFHLYNDSLSYVICVLPNGHIGNLYYGKRLSENMSYAYLLENKYRPLTAY
VYEDDDCFSLQHTRQEYASYGSGDMILPAFEISHEDGSHLSHFVFYDYAISKGKPQLSGL
PNTYVESDEEATSLELYLKDHNSETELCLTYTIYESRAVITRNAKFTQRGEKELCLKRAL
SLCLDLPDKDYEWLHLDGAWGRERYLQSSLLHQGSQSIYSLKGASSAEHNPFIALKRPDA
NEHEGEVMGFSLVYSGNFLAQVDVTPFHQTRVSMGIHPLGFEWYLKSGESFQTPEVVMVY
SHLGLNGMSQIYHDLFSQRLARGEWRDRERPILLNNWEAMTFNFNENSILSLAEVAAKLG
VELFVMDDGWFGQRNNEKAGLGDWRVNQKKLPNGLLGISQRIHQLGMLFGLWIEPEMVNK
DSDLYREHPDWILHHPKHSQSQGRHQYTLDLSREEVYQNIYQQLHDLLANHGIDYIKWDM
NRYMTEAYSYHATKEHQGAIFHRYILNLYRLYETLTSEFPHILFESCSSGGARFDPGMLY
YAPQTWTSDDTDAYERLKIQYGTSLVYPLITMGNHVSEVPNQQLLRTTPLSTRANVAYFG
SFGYEIDLMLLEEEELELIKKEIDFYKNYRRVFQFGNFTRLINPFETDDAAWQVISEDGH
HVFVGLYLGLLKLNGPSYHRLHLKGLEAEASYRLNNQVYLGSALMNAGLVINEKDFTEGY
KDFASAIYHLEKM
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaattttcgtgaaaaagaaaaagaatttcatctctataatgacagcctcagt
tatgttatttgtgtcttgccaaatgggcatattggaaatctttattatgggaaacgatta
tcagaaaatatgtcctatgcttatttattagaaaataaatatcgaccacttacagcctat
gtctatgaagatgatgattgtttttcgttacaacatacgcgtcaagaatatgcttcttat
ggcagtggagatatgattttaccagcttttgaaattagtcatgaagatggtagtcattta
tcacattttgttttttatgattatgctatttcaaaggggaagcctcaattatctggttta
cctaatacctatgtagaatctgatgaggaagcaactagtctggagctttatttaaaggat
cataatagtgaaacagaactttgtttaacttataccatctatgagagtagagctgttatc
acaagaaatgctaaatttacccaaagaggcgaaaaagagctttgtttaaaaagagccctt
agcctttgcctagacttacctgataaggattatgaatggcttcatttagatggtgcttgg
ggaagggaacgttacctacaaagttcgctattacatcaagggagccaatcaatttacagt
ttaaagggtgctagtagtgccgaacataatccttttatagctttaaaaagacccgatgca
aatgagcatgagggagaagtaatgggcttttccttagtatatagtggaaattttttagca
caggttgatgtgacaccatttcatcaaactagagttagtatggggattcatccgttagga
tttgaatggtatttaaagtcaggagaaagtttccaaacccctgaggttgttatggtttac
agtcatttaggattgaatggcatgagtcaaatctatcacgacttatttagccaacgtttg
gctagaggagaatggcgtgatagagaacggcctattcttcttaataattgggaagctatg
acatttaattttaatgaaaattccattttaagcttagctgaagtagctgctaagcttggt
gtagaactttttgttatggatgatggctggtttggtcaaaggaataatgagaaggctggc
cttggagattggcgtgtgaatcaaaaaaaacttcccaatggtttacttggtattagtcag
agaatccatcagttagggatgttatttggtttgtggattgaaccagagatggtcaacaaa
gatagcgatctctaccgagaacatcctgattggattttacatcatcctaagcattcacaa
tctcaaggacgccaccagtatacactagatttgtctcgggaagaggtatatcaaaatatt
tatcaacagttacatgatctgttagctaatcatggtattgactatataaaatgggacatg
aatcgttatatgacggaggcttacagctatcatgcgactaaagagcatcaaggagcaatc
tttcatcggtatatcctaaacctttaccgactatatgagacgttaaccagtgagtttcca
catattctatttgagtcatgctctagtggtggagcaaggtttgatccaggaatgctttat
tatgctccgcaaacatggactagcgatgatacggatgcttatgaacgtctaaaaattcag
tatggtacaagtctggtttatcctcttataactatgggaaatcatgtttcggaggttcca
aatcaacaactcttacgtaccacaccgctttctacaagagctaatgtagcttattttgga
agttttggatatgagattgacttaatgcttcttgaagaagaggaattagagctaatcaaa
aaagagattgatttttacaaaaattatcggagagtcttccaatttggtaattttacgcgt
ctaattaatccgtttgaaactgatgatgctgcttggcaagtcatctcagaagatggacat
catgtttttgtaggtctctatttaggtttgctaaaactaaatggtccttcttatcatcgt
ttacacttaaaaggtttagaagcagaagcaagttatcgtttaaataatcaagtctatcta
ggaagtgccttgatgaatgctggcttagttatcaacgaaaaagacttcacagagggctat
aaagattttgcatcagctatataccatttagaaaagatgtaa

DBGET integrated database retrieval system