KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0539Help
Entry
SAK_0539          CDS       T00278                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAK_0539
   00052 Galactose metabolism
    SAK_0539
Enzymes [BR:sak01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SAK_0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
483167..484036
Genome map
AA seq 289 aa AA seqDB search
MTIIKKNFGEKLAFLYELKNKNGMKVTLTNFGARIVDIFIPIDEHLRNISLSATSVEDYY
QKDIYVGATVAPVAGRISGAKTHIKGKCYHFTENEPNRTLHSGVDTSVEQYWSTEIEDKE
NKIIFSLFLPDGKNGFPGNVTVIATYQLTEENELKVNYQAQSDCDTIFNPTNHVYFNLTG
DFQKSVASHQLKISSQEFVPLGKDHLPTGEILTVEGTDFDFREFALFSKGLNRFSFQTRL
VNGFDHPWLLEVGNNAVEVVSPDNKISLIDFLRNKIWYNRLPAKQNMVQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgactattattaagaaaaacttcggagagaagctggcattcctctacgaattaaaaaat
aaaaatggaatgaaggtcactttgacgaattttggtgcacgtatagttgatatcttcatt
ccgattgatgaacacttgcgtaatattagtttatcggctacttctgttgaagattattat
caaaaagatatttatgtgggggcaacggtggcccctgtggcaggtagaatttctggagct
aaaacccatatcaaaggaaaatgttatcattttactgaaaatgaacctaataggacatta
catagtggtgttgatacatctgtagaacagtattggtctacagaaatagaagataaagag
aataaaattatcttttctctctttcttccggatggtaaaaatggctttcctgggaatgtg
actgtgatagctacttatcagttgacagaagaaaatgaactcaaggtcaactatcaagca
caatctgattgtgataccatttttaacccaacaaatcatgtatattttaatttaacaggg
gattttcaaaaatccgttgctagccatcagttaaagatttcaagccaagagtttgtgcca
ctagggaaagaccatttacctactggtgaaatactgactgtggaaggtacagactttgat
tttagagaatttgcccttttttcaaaaggtctaaatcgcttttctttccaaacgagatta
gtaaacggatttgatcatccgtggcttttagaagtaggcaataatgccgttgaggtagtt
agtcctgataataaaataagcttaatagacttcctgcgaaacaaaatatggtacaataga
cttcctgcgaaacaaaatatggtacaatag

DBGET integrated database retrieval system