KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0573Help
Entry
SAK_0573          CDS       T00278                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAK_0573
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAK_0573
   00052 Galactose metabolism
    SAK_0573
   00500 Starch and sucrose metabolism
    SAK_0573
   00520 Amino sugar and nucleotide sugar metabolism
    SAK_0573
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAK_0573
   00524 Butirosin and neomycin biosynthesis
    SAK_0573
Enzymes [BR:sak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAK_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
514803..515771
Genome map
AA seq 322 aa AA seqDB search
MSKKLLGIDLGGTTIKFGILTLEGEVQEKWAIETNTLENGRHIVSDIVESLKHRLSLYGL
TKDDFLGIGMGSPGAVDRTSKTVTGAFNLNWADTQEVGSVIEKEVGIPFFIDNDANVAAL
GERWVGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMIVDPENGFTCTCG
NKGCLETVASATGVVRVARQLAEQYEGSSAIKAAIDNGDTVTSKDIFIAAEDGDKFANSV
VERVSRYLGLAAANISNILNPDSVVIGGGVSAAGEFLRSRVEKYFVTFAFPQVKKSTKIK
IAELGNDAGIIGAASLANQQAS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaattattgggaattgacctcggaggaacgaccattaaatttggtatcttg
acgcttgagggagaagtacaagaaaaatgggcaattgagaccaatactttagaaaacgga
agacatatcgtttctgatatcgttgaatctctcaaacatcgtttgagcctctatggatta
acaaaagatgactttctcggtatcggtatgggttctccaggagctgttgatagaactagt
aaaacagtaacaggtgcttttaatctaaattgggctgatactcaagaagtaggttcagtt
attgaaaaagaagttggaattccattttttattgataacgatgctaatgttgcagcactt
ggtgaacgctgggtaggtgctggtgccaataatcccgacgttgttttcgtaaccctcgga
acaggagtaggtggaggtgttatcgcagatggtaacctcatccatggtgttgcaggagca
ggtggagaaattgggcatatgattgttgatccagaaaatggatttacgtgcacatgtggt
aacaaaggctgccttgagacagttgcatcagcgacaggtgttgttagagtagcacgtcaa
ctcgcagaacaatatgagggttcgtctgccattaaagcagcgattgacaacggtgatact
gttacaagtaaagatatttttatagcagcagaagatggggataaatttgctaattctgtt
gttgaacgtgtatcacgttaccttggactggcagcagctaatatttcaaatattttaaac
cctgattctgtggttattggtggcggtgtctcagcagcaggtgaatttttacgtagtcgc
gttgagaaatactttgtcacatttgctttcccacaagttaaaaagtcaactaaaattaag
attgctgaactaggtaatgatgctggtattattggtgcagcaagcttagccaatcaacaa
gcaagttaa

DBGET integrated database retrieval system