KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0666Help
Entry
SAK_0666          CDS       T00278                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sak01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sak00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sak00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sak00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:sak00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
598289..600220
Genome map
AA seq 643 aa AA seqDB search
MSNFYKLLKEKFPRKEDIVTEMINLEAICQLPKGTEYFISDLHGEYDAVDYLLRTGAGSI
RAKLLDCFDWQKIVAVDLDDFCILLYYPKEKLAFDKMNLSASAYKTKLWEMIPLQIQVLK
YFSSKYTKSKVRKQLSGKFAYIIEELLAEIDRNPEKKSYFDTIIEKLFELDQVEDLIIVL
SQTIQVLIIDHLHVVGDIYDRGRYPDRILNRLMAFPNLDIQWGNHDVTWMGAASGSYLCM
VNVIRIAARYNNITLIEDRYGINLRRLVDYSRRYYEPLPSFVPILDGEEMTHPDELDLLN
MIQQATAILQFKLEAQLIDRRPEFQMHNRQLINQVNYKDLSISIKEVVHQLKDFNSRCID
SKNPSRLTSEEEELLQQLMIAFQTSESLKKHIDFLFEKGSMYLTYNDNLLFHGCIPMHSN
GDFKSFKIAGKTYGGRDLLDLFESQIRLAYARPEKHDDLATDIIWYLWCGENSSLFGKNA
MTTFERYYVSDKVTHQERKNPYFKLRDKDDICTALLQEFDLPKFGHIVNGHTPVKEKNGE
QPIKANGKMLVIDGGFAKGYQKNTGLAGYTLIYNSYGIQLISHLPFTSIEEVLSGTNYII
DTKRLVEEAKDRILVKDTTIGQKLTKEIKDLDHLYRHFQEYDD
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatttttataagctcttgaaagaaaaatttcctcgaaaagaagatatcgtaaca
gaaatgatcaatttagaagctatttgtcaattacccaaagggacggagtattttattagt
gatttacacggggaatacgatgctgttgattatctcttacggacaggtgcagggtctatt
agagctaaattattagactgttttgattggcagaaaatagttgctgttgatttagatgat
ttttgtatactgctttattacccaaaggaaaaattagccttcgataaaatgaacttgtca
gcaagtgcttataaaacgaagttatgggaaatgattccgttacaaatacaagttttaaaa
tatttttctagtaaatatacaaaatctaaagtacgtaagcaattgtcaggtaagtttgct
tacattatcgaagaacttttagctgagattgaccgtaacccagagaagaaaagctatttt
gatactattattgaaaaattatttgaattagaccaagtagaagatttaattatagtattg
tcccaaacaattcaagttttgattattgaccatttacatgttgtaggggatatttacgat
cgtggtaggtatcctgatcgtatcttgaataggttaatggcttttccaaatttggatatc
caatgggggaaccatgatgtcacttggatgggagcagcatctggttcttacctttgtatg
gtaaatgttatccgtattgctgcacgttataataatattactttaattgaagaccgatat
ggtatcaatttgcgtcgcttggttgattactcacgccgttactatgaacctctaccttct
ttcgttcctatattagatggagaggaaatgactcatccagatgaactagacttgttaaat
atgatacaacaagcaacagcaattttacagtttaaattggaagcccaattgattgacagg
cgtccagaatttcaaatgcataatcggcaacttattaaccaggtaaattataaagattta
agtatatctattaaggaagttgtgcatcaacttaaagattttaatagtagatgcattgat
tcgaaaaatcccagtcgattaacaagtgaggaagaagagcttttacaacaattgatgata
gccttccagacttctgaaagtttaaagaaacatattgatttcctatttgaaaaaggaagt
atgtatttaacatataatgataatcttttattccatggttgcataccaatgcatagtaat
ggtgattttaaaagctttaaaattgcaggaaaaacttatggtggtagggatttactggat
ttatttgaaagtcaaatacgtctagcatatgctagaccagagaaacatgatgatttggcg
acagatatcatttggtatctttggtgtggtgaaaattcttctctttttggtaagaatgcc
atgactacttttgagcgctattatgtttccgacaaagtaactcatcaagaaagaaaaaat
ccctactttaaactgagagataaagatgatatttgcactgctcttttacaagagtttgat
ttgcctaagtttgggcatattgtcaatggtcatacgccagtcaaagaaaaaaatggtgag
caaccgataaaagcaaatggtaagatgttagtaattgatggtggctttgccaaaggttat
cagaaaaatacaggtttagctggctacactttgatttataatagctatgggatacaatta
atttcacaccttccttttacatccattgaggaagttttaagtggaaccaactatatcatt
gatacgaagcgattagtagaagaagccaaggataggattcttgtaaaagatacaactatt
ggacaaaagttaaccaaagagattaaagacttagatcacctttatcgtcattttcaggaa
tatgatgactag

DBGET integrated database retrieval system