KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0831Help
Entry
SAK_0831          CDS       T00278                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sak00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sak00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
774909..776699
Genome map
AA seq 596 aa AA seqDB search
MTHLVDLTKKPFNLNQEAIEWIEKTINEMTLDEKIGQLFFNMGASRSEEYLTDVLDRYHI
AAVRYNRGSSSEIYDQNLILQTKSKLPMLIAANTEAGGDGAVTDGTKVGDEIKVAATNDP
KYAYEMGRIAGMEASAVGCNASFAPIVDLTRNWRNPIIASRNWGANVDQIISLSKEYMKG
IMQYNIVPFAKHFPGDGIDERDHHLSFASNPMSKEEWMSTFGRIYGELADAGLPGVMAGH
IHLPNVEKEMHPERDLDDMLPASLNKTLLDELLRGELGYNGAIVTDASHMVGMTASMPRR
DLLPTAIEAGCDLFLFFNDPDEDIQWMKEGYEKGILTEERLHDALRRTLGLKAKLGLHNY
EGRRQELFMPKDKAMALINTLESQKIADEVADKAVTLVKDKQKDIFPVNPERYRHILLVN
VEGYKGGFGAMIAGNKQRASDYMKELLEERGHEVTVWESTEERIMKLPQEERAAAIANVY
AQKQPIENLTEHYDLIINLVDVNAGGTTQRIIWPAAKGTPDQPFYVHEIPSIVISVQHAF
ALADMPQVGTYINAYDGLPSTISAVVAKLAGESEFTGVSPVDAYCGLIDTHLWRQC
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacacatttagttgacttaacaaaaaaaccctttaacctaaatcaagaagcaattgag
tggattgaaaaaacaattaatgagatgacattggatgagaaaattgggcaactttttttc
aatatgggagctagtcgttcagaagaatatttaacagatgttttggatcggtatcatatt
gctgctgttcgctataatagaggtagttcaagtgaaatctatgatcagaatttaatttta
cagacaaagtcgaaattgccgatgttgattgctgcaaatacagaagctggtggagacggt
gctgtcacagatggaactaaagttggcgatgaaataaaagtggctgctacaaatgatccg
aaatatgcttatgaaatgggaagaatcgcagggatggaggcatctgctgtgggttgtaat
gcttcatttgctccaattgtagatttgacacgtaattggcgtaatcctatcatagctagt
cgaaattggggtgctaacgttgatcaaattatctcactttcaaaagagtatatgaaagga
atcatgcaatataatattgtacctttcgctaaacattttccaggggatggcattgatgag
cgtgatcatcatttgtcatttgcttccaatcctatgagtaaagaggaatggatgtcgaca
tttggccgcatttatggtgaattggctgacgcaggtctaccaggagtcatggcaggtcac
atacatttaccaaatgttgaaaaagaaatgcatccagagcgagaccttgatgatatgtta
ccagcttcattgaataaaacacttttagatgagttattgagaggagagttaggttataat
ggagctattgtaacggacgcttctcatatggttggaatgactgcttcaatgccaaggaga
gatttgttgccaacggcgattgaagcaggttgtgacttgttcttattctttaatgacccc
gatgaagacattcaatggatgaaagaaggttacgaaaaaggtattctaacagaggaacgt
ctccatgacgctttacgtcgtactctcggtctaaaagcgaaattaggcttgcataactat
gagggacgtcgccaagaactctttatgcctaaagataaggctatggctttaatcaacaca
ttagagtcgcaaaaaatagctgatgaagttgctgataaagcagtaactctggtaaaagat
aaacaaaaagatatctttccagtaaatccagaacgttatcgtcatatcttacttgttaac
gttgaaggatataagggaggttttggtgcgatgattgctggaaacaagcaacgtgcatcg
gattacatgaaagagttacttgaggaacgtggccatgaagtaactgtctgggagtctacc
gaagagcgtattatgaaattgcctcaagaggagcgggcagcagctatcgctaatgtttac
gcacaaaaacagccaatcgaaaatctaacagaacactatgacctgattattaacttggta
gatgtcaatgctggaggaacaacacaacgtattatttggccagcagctaaaggcacccct
gatcagcctttttacgttcatgaaataccatctattgtgatttcagtgcaacatgcattt
gctttagcagatatgccacaggtagggacttatattaatgcttacgatgggcttcctagc
acgataagtgcagtagttgcgaaattggctggagaatcagaatttacaggagtttcacca
gtagatgcttactgtggtttaattgatacacatttatggcgtcaatgctaa

DBGET integrated database retrieval system