KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0878Help
Entry
SAK_0878          CDS       T00278                                 

Definition
(GenBank) phosphoglycerate mutase family protein
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(823685..824326)
Genome map
AA seq 213 aa AA seqDB search
MKFYLVRHGKTQWNLEGRFQGANGDSPLLEEAIEELEELGQYLSSIHFDAVYSSDLGRAR
DTVNILNDANSCPKEIHYTPQLREWALGTLEGCKIATMQAIYPRQMTAFYQNPLQFKHDM
FGAESLYQTTHRVESFLRSLASKNYDKVLIVGHGANLTASIRSLLGYQYGSLHYKDKLDN
ASLTIIETHDFKDFNCLTWNDKSYLRQEVKMTH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttatcttgttagacacggaaaaacacaatggaatttagaggggcgtttccaa
ggtgctaacggagactcacctctccttgaagaagctattgaagaattagaagaacttgga
caatacctatcatctattcattttgatgctgtttattctagcgacttaggtcgtgctaga
gatactgttaatatcctcaatgatgctaattcatgcccaaaagaaatccactatactcct
caacttcgtgaatgggcattgggaactttagaaggttgtaaaattgcaactatgcaagct
atctatcctcgtcaaatgaccgcattttatcaaaatcccttacaatttaaacatgacatg
ttcggtgcagaatctctttatcagacaacgcatcgtgtagagagtttcttacgttctcta
gcttcaaaaaattacgacaaggtccttattgtaggacatggagcaaacctaactgcgtct
attcgttccttactgggttatcaatatggtagtttacactacaaagataaacttgataat
gccagcctcacaatcatagaaactcatgattttaaagacttcaactgtctgacttggaac
gataaatcttatttaaggcaagaggtcaaaatgacacactaa

DBGET integrated database retrieval system