KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0878Help
Entry
SAK_0878          CDS       T00278                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAK_0878
   01230 Biosynthesis of amino acids
    SAK_0878
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAK_0878
  Energy metabolism
   00680 Methane metabolism
    SAK_0878
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAK_0878
Enzymes [BR:sak01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     SAK_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(823685..824326)
Genome map
AA seq 213 aa AA seqDB search
MKFYLVRHGKTQWNLEGRFQGANGDSPLLEEAIEELEELGQYLSSIHFDAVYSSDLGRAR
DTVNILNDANSCPKEIHYTPQLREWALGTLEGCKIATMQAIYPRQMTAFYQNPLQFKHDM
FGAESLYQTTHRVESFLRSLASKNYDKVLIVGHGANLTASIRSLLGYQYGSLHYKDKLDN
ASLTIIETHDFKDFNCLTWNDKSYLRQEVKMTH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttatcttgttagacacggaaaaacacaatggaatttagaggggcgtttccaa
ggtgctaacggagactcacctctccttgaagaagctattgaagaattagaagaacttgga
caatacctatcatctattcattttgatgctgtttattctagcgacttaggtcgtgctaga
gatactgttaatatcctcaatgatgctaattcatgcccaaaagaaatccactatactcct
caacttcgtgaatgggcattgggaactttagaaggttgtaaaattgcaactatgcaagct
atctatcctcgtcaaatgaccgcattttatcaaaatcccttacaatttaaacatgacatg
ttcggtgcagaatctctttatcagacaacgcatcgtgtagagagtttcttacgttctcta
gcttcaaaaaattacgacaaggtccttattgtaggacatggagcaaacctaactgcgtct
attcgttccttactgggttatcaatatggtagtttacactacaaagataaacttgataat
gccagcctcacaatcatagaaactcatgattttaaagacttcaactgtctgacttggaac
gataaatcttatttaaggcaagaggtcaaaatgacacactaa

DBGET integrated database retrieval system