KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0888Help
Entry
SAK_0888          CDS       T00278                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAK_0888 (tpiA)
   01230 Biosynthesis of amino acids
    SAK_0888 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAK_0888 (tpiA)
   00051 Fructose and mannose metabolism
    SAK_0888 (tpiA)
   00562 Inositol phosphate metabolism
    SAK_0888 (tpiA)
Enzymes [BR:sak01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAK_0888 (tpiA)
Exosome [BR:sak04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAK_0888 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAK_0888 (tpiA)
  Exosomal proteins of melanoma cells
   SAK_0888 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
835633..836391
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFIEAVASKLPSSELVEAGIAAPALTLSTVLEAAKGSEL
KIAAQNSYFENSGAFTGENSPKVLAEMGTDYVVIGHSERRDYFHETDQDINKKAKAIFAN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQAVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaataaaaatccagaagaagca
aaagcattcatcgaagcagtagcttctaaattaccatcatcagaacttgttgaagcaggg
attgctgctccagcgcttactttatcaacagttcttgaagcagctaaaggttcagaattg
aaaatcgctgctcaaaatagctattttgagaattcaggtgcattcactggtgaaaacagc
cctaaagtattggctgaaatgggtacagactacgttgttatcggtcactcagaacgtcgt
gattatttccatgaaactgaccaagatatcaacaaaaaagcaaaagctatctttgctaat
ggtttgactccaatcatttgttgcggtgagtctcttgaaacttacgaagctggtaaagcg
gttgaattcgtaggtgctcaagtttcagcagctcttgcaggtttgtcagaagagcaagta
tcatcacttgttatcgcttacgaaccaatctgggctattggtactggtaaatcagcaact
caagacgacgcacaaaacatgtgtaaagcagttcgtgacgttgttgcagcagacttcggt
caagcagttgctgacaaagttcgcgttcaatacggtggttcagttaaacctgaaaacgtt
gcagaatatatggcttgcccagacgttgacggtgcccttgtaggtggagcttcacttgaa
gcagaaagcttccttgccttattagattttgttaaataa

DBGET integrated database retrieval system