KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0889Help
Entry
SAK_0889          CDS       T00278                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAK_0889 (gpmA)
   01230 Biosynthesis of amino acids
    SAK_0889 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAK_0889 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SAK_0889 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAK_0889 (gpmA)
Enzymes [BR:sak01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAK_0889 (gpmA)
Exosome [BR:sak04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAK_0889 (gpmA)
  Exosomal proteins of melanoma cells
   SAK_0889 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
836568..837260
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIQAAGIEFDLAFTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPDMAKDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDEKLNLVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtattcgcacgccacggtgaatctgagtggaataaagctaaccttttc
actggatgggctgacgtagatctttcagaaaaaggtacacaacaagctattgatgctggg
aaattaattcaagcagcaggtattgagttcgaccttgcttttacatcagttcttaaacgt
gccatcaaaacaactaaccttgcccttgaagcagctgatcaactttgggtaccagttgaa
aaatcatggcgcttaaacgaacgtcattacggtggattgacaggaaaaaataaagcagaa
gcagctgaacaatttggtgatgagcaagttcatatttggcgtcgttcatatgatgtattg
cctccagatatggctaaagatgatgaacattcagcacatactgatcgtcgctatgcttca
ctagatgattctgttattccagatgcagaaaacctaaaagttactttagagcgtgctctt
cctttctgggaagataaaattgctcctgctcttaaagatggtaaaaatgtgtttgttggt
gcacacggtaactcaatccgtgctcttgtaaaacatatcaaacaattgtcagatgatgaa
atcatggacgttgaaattcctaacttcccaccacttgttttcgaatttgatgaaaaatta
aaccttgtttcagaatattacttaggtaaataa

DBGET integrated database retrieval system