KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0916Help
Entry
SAK_0916          CDS       T00278                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAK_0916
Enzymes [BR:sak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SAK_0916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
866797..868224
Genome map
AA seq 475 aa AA seqDB search
MTVFPKHFLWGGAVAANQVEGAFRTDGKGLSVQDVLPNGGLGDFTAKPTPDNLKLEAIDF
YHNYKNDIKLFAEMGFKVFRTSIAWSRIFPNGDDSAPNEAGLQFYDNLFDELLKYNIEPL
VTLSHYETPLHLAKTYNGWADRRLIAFFEKFAQTVMERYKDKVKYWLTFNEVNSILHMPF
TSGAIMTDKSQLSPQELYQAIHHELVASARVTKLGRSINPNFKIGCMILAMPAYPMTSDP
RDVLAARQFEQHNLLFSDIHVRGKYPTYIQSYFKNNGIKIKFEEGDEEVLAQNTVDFLSF
SYYMSVTQAYDFENYQSGQGNILGGLTNPHLTTSEWGWQIDPIGLRLVLNQYYERYQIPL
FIVENGLGAKDQLIETLDGDYTVEDDYRIDYMNQHLVQVAKAIEDGVEIMGYTSWGCIDC
VSMSTAQLSKRYGLIYVDRNDDGTGSLQRYKKKSFGWYQKVIKTNGQSLFEHHNR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacggtttttcctaaacattttctatggggaggtgcagttgctgccaatcaggtagag
ggtgcatttagaacagatggcaaaggtttatctgtacaagatgtacttccaaatggtggt
ttaggcgatttcaccgccaaacctactccagacaatttgaagctagaagcaattgatttt
tatcataactataaaaatgatataaaactgtttgcagagatgggctttaaagtttttaga
acctctattgcctggtctcgaatttttccaaatggtgatgatagtgctccaaacgaagct
ggcttacaattttatgataatttatttgatgagttgcttaaatataatatcgagcccttg
gttaccttatctcattatgaaacaccgcttcatcttgcaaaaacttataatggttgggct
gatagacgtttgatagcattttttgagaaatttgctcaaacagtcatggagcgttataaa
gataaggtgaaatattggttgacttttaatgaagtgaattctattttacatatgcctttc
accagtggtgctattatgaccgacaaatcacaactaagtcctcaggagctttatcaagct
attcatcatgaattagtagcatcggctagagtgacaaaattagggcgttctatcaatcct
aattttaaaattggctgtatgattctggctatgccagcttatcctatgacatctgatcca
agagatgtcctggctgcaagacaatttgaacaacataatctgctattttcagatatacat
gtcagaggtaaatatcccacttatattcagtcctatttcaaaaataatggtattaaaatt
aaatttgaagaaggagatgaggaagtattggcacaaaatacagtagattttctatcgttt
agttactatatgagcgtgacacaagcttatgactttgaaaattatcaaagtggtcaggga
aatatccttggaggcctaactaatcctcatttaacaacttcagaatggggatggcaaatc
gatcccatcgggctacgcctagtcttaaatcagtattatgaacgttatcagattccgttg
tttattgtagaaaatggattgggagcaaaagatcaattgatagaaacactagacggtgat
tatactgtcgaagatgattatcgtattgattatatgaatcaacatttagttcaagttgct
aaagctattgaagatggtgttgaaataatgggatatacatcttgggggtgtattgattgt
gtatccatgtctacagctcaactaagtaaacgttatggtctaatatatgttgatcgaaat
gatgatggaacagggagtctacaacgttacaagaagaagtcatttggttggtaccaaaaa
gtgattaagacaaatggccaatcattgtttgaacatcataacagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system