KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0976Help
Entry
SAK_0976          CDS       T00278                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAK_0976 (glgB)
Enzymes [BR:sak01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SAK_0976 (glgB)
Exosome [BR:sak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAK_0976 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
931655..933523
Genome map
AA seq 622 aa AA seqDB search
MSNKDELYTFGIGENFHLQNYLGVHSENGSFCFRVWAPNAENVQVIGDFTDWRNRPLQMN
KNQAGVWEANSLDAREGDLYKYLVTRKGGQVVEKIDPMAVYMERRPGTASVIKVLRNKKW
EDGLWMGRRKRLGFQKRPINIYEVHAGSWKKDDFGHPMTFSQLKDYLIPYLVEMNYTHVE
FMPLMAHPLDMSWGYQLMGYFAFEHTYGTPEEFQDFVEACHKNNIGVLVDWVPGHFIQND
DALAYFDGTATYEYQNHDRAHNYRWGALNFDLGKNQVQSFLISSALFWIEHYHIDGIRVD
AVSNMLYLDYDEGPWEANQFGDNRNLEGYHFLRKLNKVIKERHPNVMMIAEESTASTPIT
KDLESGGLGFDFKWNMGWMNDILRFYEEDPLYRQYDFNLVTFSFMYIFNENFVLAFSHDE
VVHGKKSMMHKMWGDRYNQFAGLRNLYAYQMCHPGKKLLFMGSEFGQFLEWKYNDQLEWE
NLNDDMNQKMQRYTKQLNQFYKDHKCLWRIDDSFDGLEIIDADNKSETVLSFIRKDDKGD
LLLCVFNMTPVERPNFTIGVPQAGIYEEVLNTEMEEFGGVWKNHNPVTKTQVATWKDYDH
TLSFTLPALGASVWRIKRRLRK
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtccaataaagatgagttatatacttttggaataggtgaaaattttcatctccagaat
tatttaggcgtacatagcgaaaatggaagcttttgtttcagagtttgggctcctaatgct
gaaaatgttcaagttattggagattttacagattggcgaaatcgacctctccaaatgaac
aaaaatcaagcaggagtttgggaagctaacagtttggatgcgcgcgaaggtgatttatat
aaatatttggttactcgtaaaggtggtcaagtagttgagaaaatcgatcctatggcagtt
tatatggaaagacgtcctggaactgcaagtgttattaaagttcttagaaataaaaagtgg
gaagatggtctttggatgggaaggcgcaaacgtctgggttttcagaagcgtccaattaat
atttacgaagttcatgctggttcatggaaaaaagatgattttggacatcctatgactttt
tctcagttaaaagattacttaatcccctaccttgttgagatgaattatactcatgttgaa
tttatgcccttaatggcacatccgcttgatatgagttggggatatcaattaatggggtat
tttgcttttgaacatacctatggtactccagaagaatttcaagactttgtagaagcatgt
cataaaaataatataggagttcttgtagattgggttccaggacactttattcagaatgac
gatgctttagcctatttcgatggaactgctacttatgagtatcaaaatcatgatcgtgcg
cataactatcgatggggagctctgaactttgatttaggaaaaaatcaagtacaatccttt
ttgatttcgagtgccttgttctggattgaacattatcatattgatggtattcgtgttgat
gcggttagtaatatgttatatctcgattatgatgaaggaccatgggaagctaaccaattt
ggggataatcgtaatttggaaggatatcactttttaaggaaacttaacaaagtaattaaa
gagcgtcatcctaatgttatgatgattgctgaagagtcaacagcttctaccccaataact
aaagacttagagtctggaggattgggttttgactttaaatggaatatgggctggatgaat
gatatcctgcgtttttatgaagaagatcctctctataggcaatatgattttaatttagtg
acttttagttttatgtatatattcaatgagaactttgtactagctttttcacatgatgaa
gtagtacatggtaaaaagagtatgatgcataaaatgtggggtgaccgttataatcaattt
gctggtttacgtaatttatatgcatatcaaatgtgtcatcctgggaaaaaacttctcttt
atgggaagtgagtttggtcaatttttagaatggaaatataatgatcaactagaatgggaa
aacttaaatgatgatatgaaccaaaagatgcaacgctatactaaacaattgaatcaattt
tataaagatcataagtgcctatggcgtattgatgattcctttgacgggctagaaattatt
gatgcggataataaatctgaaactgttttatcttttatacgaaaagatgataaaggcgat
ttgttactttgtgtctttaatatgactcctgtagaacgccctaactttactattggtgtt
ccgcaagcgggtatttatgaagaagttttaaatactgaaatggaagagtttggaggtgtt
tggaaaaaccacaatcctgtaacgaaaacacaagtggctacatggaaagattatgatcat
actttaagttttacattaccagcccttggggcaagtgtttggagaataaaacgtcggctt
cgtaaataa

DBGET integrated database retrieval system