KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0989Help
Entry
SAK_0989          CDS       T00278                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sak00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sak00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
944268..945539
Genome map
AA seq 423 aa AA seqDB search
MDKIIVEGGQTQLQGQVVIEGAKNAVLPLLAATILPSQGKTLLTNVPILSDVFTMNNVVR
GLDIQVDFNCDKKEILVDASGDILDVAPYEFVSQMRASIVVLGPILARNGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGATITQNGGDITAQAEKLKGANIYMDFPSVGATQNLMMAATLA
SGTTTIENAAREPEIVDLAQLLNKMGAKVKGAGTETLTIIGVDALHGTEHDVVQDRIEAG
TFMVAAAMTSGNVLVKDAIWEHNRPLISKLMEMGVEVSEEEDGIRVKADTKKLKPVTVKT
LPHPGFPTDMQAQFTALMAVVNGESTMIETVFENRFQHLEEMRRMGLQTEILRDTAMIHG
GRALQGAPVMSTDLRASAALILAGMVAQGQTVVGQLTHLDRGYYQFHEKLAALGANIKRV
SEA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattattgtggaaggtgggcaaacgcagcttcaaggtcaagttgttattgaa
ggagctaaaaatgcagttttacctcttttagcagccacaattttaccaagccaagggaaa
acattgttgaccaatgttcctatcttgtctgatgtatttacaatgaacaatgttgttcgt
ggtttagatattcaagttgactttaattgcgataaaaaagaaatcttagtggatgcctca
ggtgatattttagatgttgcaccttatgaatttgttagtcaaatgagagcttctattgtt
gttttgggacctattttagctagaaatggccatgctaaggtttcaatgccaggcggttgt
acaattggtagccgaccaattgaccttcatcttaaaggtttagaagctatgggagctacg
attacacaaaatggtggtgatattactgcccaagctgaaaagcttaagggagctaatata
tacatggattttccctcagtcggtgccactcaaaacttaatgatggctgctacacttgct
tcaggcacaacaacgatagagaatgctgcacgtgaaccagaaattgtagaccttgcgcag
ttactaaataaaatgggagctaaagtaaagggtgctggtacggaaacattaacgatcatt
ggtgttgatgctttacatggtacagaacatgatgttgtccaagatcgtattgaagctgga
acctttatggtggcagctgctatgacttctggaaatgttctagtaaaggatgctatttgg
gaacataaccgtcctttaatctctaaattgatggagatgggtgttgaagtgtcagaggaa
gaagatggtattcgtgtaaaagctgatactaaaaaattgaagccagtgactgtgaaaaca
ctccctcatccaggatttcctactgatatgcaagctcaatttacagctctaatggcagta
gttaatggcgaatcaactatgattgagacagtttttgaaaatcgttttcaacatttggaa
gaaatgcgtcgcatgggattacaaacggaaattttacgagatactgcaatgattcatggt
gggagagctttacaaggtgcaccggtcatgtctactgacttacgagctagtgcagcttta
atcttggcaggaatggttgcgcaagggcaaacagtagttggccaattaacccatttagac
cgtggttattatcaattccatgaaaaattagcggctcttggtgctaatattaaacgtgta
agtgaggcgtaa

DBGET integrated database retrieval system