KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1188Help
Entry
SAK_1188          CDS       T00278                                 

Gene name
arb
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sak00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1165263..1166699)
Genome map
AA seq 478 aa AA seqDB search
MVKQVFPKGFLWGGATAANQCEGAYNVDGRGLANVDVVPTGEDRFAIISGQKKMFDFEEG
YFYPAKESIDFYHHYKEDLALLAEMGFKTYRMSIAWTRIFPKGDELYPNEAGLQFYENIF
KECRKYGIEPLVTITHFDCPIYLIKHYGGWRSRKMIGFYERLVRALFTRFKGLVKYWLTF
NEINMILHAPFMGAGLYFEDGENQEQIKYQAAHHELVASAIAVKIAHEVDPNNQIGCMLA
AGQYYPNTCHPQDYWASMQKNRENYFFIDVQARGKYPNYAKKHFEHLGISIQMTAEDLAL
LRDYTVDFISFSYYSSRVASSNPTVSEQVQENIFASLKNPYLKSSEWGWQIDPLGLRITL
NAIWDRYQKPMFIVENGLGAVDIPDENGYVEDDYRIDYLRQHIAAMRDAIYVDGVNLIGY
TTWGCIDLVSAGTGEMEKRYGFIYVDRNNKGEGTLKRYKKKSFYWYKKVIASNGSQIE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacaagtatttccaaaaggttttttatggggcggggcaactgctgccaatcaa
tgtgaaggagcttacaatgttgatggacgtggcctagcaaatgtagatgttgttcctact
ggagaagatcgatttgcaattatttcaggacaaaagaaaatgtttgattttgaggaagga
tacttttatccagcaaaagaatcaatagatttttatcaccattataaagaggaccttgca
ttacttgcagaaatgggtttcaaaacctatcgtatgtcaatagcatggacgcgtattttt
ccaaagggtgatgagctatatccaaatgaagctggtcttcagttttatgaaaatattttt
aaagagtgtcgtaagtatggtattgaacctttggtaaccattacacattttgactgtcct
atctaccttattaaacattacggtgggtggcggagccgtaaaatgattggtttttatgag
cgccttgtacgagctttatttactcgttttaaggggttagttaaatattggttgaccttt
aacgaaatcaatatgattttacacgctccttttatgggcgctggcttatattttgaagat
ggtgaaaatcaagagcaaattaaatatcaagcagctcaccatgagttagtggcttcggct
attgcagtaaaaattgctcatgaagttgatccaaataatcaaatcggatgtatgctagct
gcaggtcaatactatccaaatacgtgtcatccacaagattattgggcttcgatgcaaaaa
aatagagaaaattatttttttattgatgtgcaagcgcgtggcaaataccctaattatgct
aaaaaacattttgagcatttaggtatttcaattcaaatgacagcagaagatcttgctttg
ttaagagactatacggttgattttatttcattttcttactattcaagccgagtagcttca
agtaatccaaccgtcagtgaacaggttcaagaaaatattttcgcatcacttaagaatcct
tacttgaaatcttctgaatggggatggcaaattgatccgcttggattacgtattacctta
aatgctatctgggatcgttatcaaaaaccgatgtttattgttgaaaatggacttggagca
gtagatattcctgatgagaatggttacgtagaagatgattatcgtattgattacctccgt
cagcacattgctgcaatgagagatgctatatatgtagatggtgttaatctaattggctat
actacatggggatgtattgatttagtatctgcaggaactggtgaaatggaaaaacgctat
ggtttcatttatgttgatcgcaataataaaggagaggggacactcaagcgttacaagaaa
aaatcgttttattggtataagaaggttattgcaagtaatggcagtcaaatagaataa

DBGET integrated database retrieval system