KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1286Help
Entry
SAK_1286          CDS       T00278                                 

Gene name
rmlC
Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SAK_1286 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAK_1286 (rmlC)
Enzymes [BR:sak01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SAK_1286 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1260298..1260891)
Genome map
AA seq 197 aa AA seqDB search
MTEQFFDKELTCRPIEAIPGLLEFDIPVRGDNRGWFKENFQKEKMIPLGFPESFFEADKL
QNNISFNKKNTLRGLHAEPWDKYVSIADEGRVIGTWVDLREGDSFGNVYQTIIDASKGIF
VPRGVANGFQVLSDKAAYTYLVNDYWALELKPKYAFVNYADPNLGIQWENLEEAEVSEAD
KNHPLLKDVKPLKKEDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaattttttgataaagaattaacttgtcgcccaattgaagccattcctgga
ttgttggaattcgatattcccgttcgtggagacaaccgtggatggttcaaagagaacttt
caaaaagaaaaaatgataccgcttggtttcccagaaagcttctttgaggcagacaaacta
caaaataatatttcgtttaacaaaaaaaatactttgcgaggtctccatgcagagccttgg
gataaatatgtttcgatcgctgatgaaggacgtgtgatcggtacttgggttgacctccgt
gaaggtgacagttttggtaacgtttaccaaacgattatcgatgcctcaaaaggtatcttt
gttccacgcggcgttgctaatggtttccaagttctttcagataaagcagcttatacttat
ctcgttaacgattattgggcacttgaactcaaaccaaaatatgctttcgttaactatgca
gatccaaatctaggcattcagtgggaaaaccttgaagaagcagaagtctcagaagcagat
aagaatcacccacttctcaaagatgtaaaacctttgaagaaggaagatttgtaa

DBGET integrated database retrieval system