KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1681Help
Entry
SAK_1681          CDS       T00278                                 

Gene name
gatC
Definition
aspartyl/glutamyl-tRNA amidotransferase subunit C (EC:6.3.5.-)
Orthology
K02435  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:sak00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1667033..1667335)
Genome map
AA seq 100 aa AA seqDB search
MKISEEEVRHVANLSKLRFSDQETKEFASSLSKIVDMIELLNEVDTEGVPVTTTMADRKT
VMREDIAQPGHNRDDLFKNVPQHQDYYIKVPAILEDGGDA
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttctgaagaagaagtgcgtcatgttgccaatctgtcaaaattgcgcttttct
gatcaagagactaaagaatttgcgtcaagtttgtcaaagattgttgatatgattgaactc
ttaaatgaagttgacacagaaggcgtaccagtaacaacgaccatggcagatcgcaaaacc
gtgatgcgtgaagatattgctcaaccaggccataatcgtgatgacttatttaaaaatgta
ccacagcatcaagattattatattaaagtacctgcaattcttgaggatggaggagatgcc
taa

DBGET integrated database retrieval system