KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1819Help
Entry
SAK_1819          CDS       T00278                                 

Gene name
xpkA
Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAK_1819 (xpkA)
Enzymes [BR:sak01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     SAK_1819 (xpkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1810687..1813065)
Genome map
AA seq 792 aa AA seqDB search
MSEFDTKSYLEKLDAWWRAANYISAAQMYLKDNPLLRRELVENDLKVHPIGHWGTVPGQN
FIYAHLNRAINKYDLDMFYIEGPGHGGQVMVSNSYLDGSYTELNPNIEQTEDGFKQLCKI
FSFPGGIASHAAPETPGSIHEGGELGYALSHATGAILDNPDVIAATVIGDGEGETGPLMA
GWLSNTFINPVNDGAVLPIFYLNGGKIHNPTIFERKTDEELSQFFEGLGWKPIFADVVEL
SEDHAAAHALFAEKLDQAIQEIKTIQSEARQKPAEEAIQAKFPVLVARIPKGWTGPKAWE
GTPIEGGFRAHQVPIPVDAHHMEHVDSLLSWLQSYRPEELFDENGKIVDEIAAISPKGDR
RMSMNPITNAGIVKAMDTADWKKFALDINVPGQIMAQDMIEFGKYAADLVDANPDNFRIF
GPDETKSNRLQEVFTRTSRQWLGRRKPDYDEALSPAGRVIDSQLSEHQAEGFLEGYVLTG
RHGFFASYESFLRVVDSMVTQHFKWLRKSKTHTTWRKNYPALNLIAASTVFQQDHNGYTH
QDPGILTHLAEKTPEYIREYLPADTNSLLAVMDKAFKAEDKINLIVTSKHPRPQFYSIAE
AEELVAEGYKVIDWASNVSLNQEPDVVFAAAGTEPNLEALAAISILHKAFPELKIRFVNV
LDILKLRHPSQDARGLSDEEFNKVFTTDKPVIFAFHGYEDMIRDIFFSRHNHNLHTHGYR
ENGDITTPFDMRVMSELDRFHLAQDAALASLGHEAQAFSDEMNQMVAYHKDYIREHGDDI
PEVQNWKWENIK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatttgatacaaaatcatatttagaaaaacttgatgcatggtggagagcagct
aattatatttctgcagcacaaatgtatctaaaggataaccctctcttgagacgagagctg
gttgaaaacgacttaaaggttcatccaattggtcactggggcactgtacctggacaaaat
tttatctatgctcacttaaatcgcgctattaataaatacgatttagacatgttctatatt
gaaggtccaggtcatggtggtcaagttatggtatctaattcatatttagatggttcatat
actgaattaaaccccaatattgagcaaacagaggatggctttaagcagttatgtaaaatc
ttctctttcccaggtggaattgcatcccatgcagcaccagaaacaccagggtcaattcat
gaaggcggtgaacttggttacgcactttctcatgcgacaggtgccatcctggacaatcca
gatgttattgctgcgactgttattggtgatggtgaaggtgaaacaggaccacttatggct
ggttggctatctaatacctttatcaatccagtaaatgatggtgctgttctaccaatcttc
tatttaaatggtggtaaaatccataacccaactatctttgaacgtaagacagatgaagaa
ttatctcagttttttgaaggattaggttggaaacctatttttgcagatgttgttgaactc
tctgaggatcatgcggctgctcatgctttgtttgcagaaaaattagatcaagctattcaa
gagattaaaaccattcaatcagaagcacgacaaaaaccagcagaagaagctatccaagca
aaattccctgtcttagttgcacgtattcctaagggttggactggtccaaaagcttgggaa
ggaacaccaattgaaggtggcttccgcgctcaccaagtaccaattccagtagatgcccac
catatggaacatgttgattctcttttgtcatggcttcaatcataccgtccagaagaatta
tttgatgaaaatggtaaaatcgttgatgagattgctgctatttcaccaaaaggtgatcgt
cgcatgtccatgaatccaataaccaatgctggtattgttaaagcaatggatacagcagat
tggaagaaatttgctcttgatattaatgttccaggtcaaattatggcacaagatatgatt
gaatttggaaaatatgcagcagatttagtagatgctaacccagataatttccgtattttt
ggtccagatgaaacgaaatcaaatcgtcttcaagaagtgtttacacgtactagccgtcaa
tggcttggtcgtcgtaaaccagattatgacgaagctttaagtccagctggacgtgttatt
gattcccaattgtctgaacatcaagcagaaggtttcttagaaggttatgttttaactggt
cgtcacggcttctttgcttcatacgaatcattccttcgcgttgtagattcaatggtaaca
caacatttcaaatggttacgtaaatcaaaaacacacacaacatggcgtaaaaattatcca
gcgcttaacctaattgcagcttcaactgttttccaacaagatcataatggttatactcac
caagatccaggtattttaactcacttagctgaaaaaacacctgaatacattcgtgaatat
ttaccagcagatactaactcacttctagctgttatggataaagcgtttaaagctgaagat
aaaattaatttaattgtgacatctaagcaccctcgtccacaattttactctattgctgaa
gcagaagagttagtggcagaaggatataaggtgattgactgggcttcaaatgtgtcgctt
aatcaagagccagatgttgtctttgctgcggcgggaacagaacctaacttagaagctttg
gcagcaattagcattcttcataaggctttcccagaacttaagattagatttgttaatgta
ttagacatcctaaaacttcgtcatccttcacaagatgctcgcggtttatcagatgaagag
tttaacaaagtctttaccacagataaacctgttatttttgctttccatggttatgaagat
atgattcgagatattttctttagtcgtcacaatcataatttgcatacgcatggttaccgt
gaaaatggtgacatcacaacgccatttgatatgcgcgtgatgtcagaattggaccgattc
catctggcacaggatgcagctcttgcttctttaggacatgaagcgcaagccttcagtgat
gaaatgaatcaaatggttgcttatcacaaagactatattcgtgaacacggagacgatatc
ccagaagtacaaaattggaaatgggaaaatatcaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system