KEGG   Sphingopyxis alaskensis: Sala_0176Help
Entry
Sala_0176         CDS       T00361                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sal  Sphingopyxis alaskensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sala_0176 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sala_0176 (sucC)
   00640 Propanoate metabolism
    Sala_0176 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Sala_0176 (sucC)
Enzymes [BR:sal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sala_0176 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
179980..181260
Genome map
AA seq 426 aa AA seqDB search
MPRNLAYAAPNFSLFLESKGPADLMNIHEYQAKELLAKFGVAVPRGIAAMSVEEAVAAAK
QLPGPLYVVKSQIHAGGRGKGKFKELGPDAKGGVRLARSIEEVGSHAREMLGNTLVTIQT
GEAGKQVNRLYITDGADIKKEYYLALLVDRASSRIAVVASTEGGMDIETVAHNTPDKIHT
ITIDPATGLMPHHGRSVAAALELTGDLAKQAAKVLAGLYDAFLATDAEQIEINPLAVCEG
ANGDELLVLDAKLGFDGNAMFRHPDIAELRDLTEEDPAEVEASEYDLAYIKLDGNIGCMV
NGAGLAMATMDIIKLNGAFPANFLDVGGGASKEKVTAAFKIILKDPAVEGILVNIFGGIM
KCDIIADGIVAAAKEVNLSVPLVVRLEGTNVQQGKDILANSGLPIVAANDLGDAAKKIVA
EVARAA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcgcaacttggcttatgcggcgccaaacttctccctcttcctagagtcgaaaggc
ccggcagacctcatgaacattcacgaatatcaggcgaaagaactgctcgcgaaatttggc
gtcgccgtgcccaggggcatcgccgcgatgagcgtcgaggaagctgtcgcggcggcgaag
cagctaccggggccgctctatgtcgtgaagtcacaaatccacgccggtggccgcggcaag
ggcaagttcaaggaactaggccccgacgcgaagggcggcgtccgtctcgccaggagcatc
gaggaagtcgggagccacgcgcgtgaaatgctcggcaacacgctggtgacgatccagacc
ggcgaagcgggcaagcaggtcaaccggctctacatcaccgacggcgccgacattaagaaa
gaatattatctcgcgctcctcgtcgatcgcgcgtcgagccgcatcgcggtggtcgcttcg
accgaaggcgggatggacatcgagaccgtcgcgcacaacacgccggacaagattcacacg
atcaccatcgaccccgcgaccgggctgatgccgcaccacggccgcagcgtcgccgccgcg
ctcgaactgaccggcgacctcgccaagcaggcggcgaaggtgctcgccgggctttacgac
gccttcctcgcgaccgacgccgaacagatcgagatcaacccgcttgccgtctgcgaaggc
gcgaacggcgacgaactgctcgtgctcgacgcgaagctcggcttcgacggcaacgcgatg
ttccgccaccccgatatcgccgaactgcgcgatctgaccgaagaagatccggccgaagtc
gaggcgtccgaatatgaccttgcctatatcaagctcgacggcaacatcggctgcatggtc
aatggtgcgggtctcgcgatggcgacgatggacatcatcaagctgaacggcgccttcccg
gcgaacttcctcgacgtcggcggcggcgcgagcaaggaaaaggtcaccgcggcgttcaag
atcatcctgaaagaccccgcggtcgagggcatcctcgtcaacatcttcggcggcatcatg
aagtgcgacatcatcgccgacggcatcgtcgccgcggcgaaggaagtgaacctgtcggtc
ccgctcgtcgttcgcctcgaaggcacgaacgtgcagcagggcaaggacattctcgcgaac
tcgggcctgccgatcgtggcggccaacgatctgggcgatgcggcgaaaaagatcgtcgcc
gaggttgcgagggcggcgtga

DBGET integrated database retrieval system