KEGG   Sphingopyxis alaskensis: Sala_0236Help
Entry
Sala_0236         CDS       T00361                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sal  Sphingopyxis alaskensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sala_0236
   00052 Galactose metabolism
    Sala_0236
   00500 Starch and sucrose metabolism
    Sala_0236
   00520 Amino sugar and nucleotide sugar metabolism
    Sala_0236
Enzymes [BR:sal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sala_0236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(242510..243373)
Genome map
AA seq 287 aa AA seqDB search
MKPIRKAVFPVAGLGTRFLPATKAIPKEMLPVVDRPLIQYAVDEAREAGIEQMIFVTGRG
KSAIEDHFDIAFELEKTMSERGKDLSVLTPTRLGPGACAYVRQQEPMGLGHAIWCARDIV
GDEPFAIFLPDEFMHGIPGCMKQMVDAYARVGGNLISVLEVPHEQVSSYGVIAPGARDGA
LTEVKGLVEKPPVAEAPSNLIISGRYILQPEVMRVLERQEKGAGGEIQLTDAMATMIGAQ
PFHAVTFAGARYDCGSKAGYIQANLAVALERPDIAADVRAFAIDLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgatccgcaaagccgtttttcccgtcgccggcctcggcacccgcttcctgccg
gcgaccaaggcgattccgaaggagatgctgcccgtcgtcgaccggccgctcatccaatat
gcggtcgacgaagcgcgcgaggcggggatcgagcagatgatcttcgtcaccggccgcggc
aagagcgcgatcgaggatcatttcgacatcgccttcgaactggaaaagacgatgtcggag
cgcggcaaggatctgtcggtgctgacgcccacgcgcctcggccccggcgcctgcgcctat
gtccgccagcaggaaccgatggggctgggtcacgccatctggtgcgcgcgcgacatcgtc
ggtgacgagccctttgccatcttcctgcccgacgagttcatgcacggcatccccggctgc
atgaagcagatggtcgatgcctatgcgcgcgtcggcggcaatctgatctcggtcctcgaa
gtgccgcacgaacaggtgtcgagctatggcgtgatcgcccccggcgcgcgcgacggcgcg
cttaccgaggtcaaggggctggtcgagaagccaccggttgccgaagcgccgtccaatctc
atcatctcgggccgctacatcctgcaacccgaagtcatgcgcgtgctcgaacgccaggag
aagggcgccggcggcgaaatccagctcaccgacgccatggcgacgatgatcggcgcgcag
cccttccacgccgtgaccttcgccggcgcgcgctacgattgcgggtcgaaggcaggctat
atccaggccaatctggcggtcgcgctcgaacgccccgacattgcggccgacgtccgcgcc
ttcgccatcgacctgctcaaatag

DBGET integrated database retrieval system