KEGG   Sphingopyxis alaskensis: Sala_0250Help
Entry
Sala_0250         CDS       T00361                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sal  Sphingopyxis alaskensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sal03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
253889..254485
Genome map
AA seq 198 aa AA seqDB search
MVSTEIEALVQQLARLPGLGPRSARRAVLHLMKKRESAFAPLLAALQTVSERLVTCTTCG
NIDTHDPCAICADPRRDARSLCVVEEVSDLWALDKSRLFPGKYHVLGGRLSALEGVRPQD
LSIDALVTRVAAGGIDEVVLAMNATLEGQTTAHYLAERLEGYPVRLTQLAHGLPVGGELD
YLDEGTLAQALRARRPVG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaaccgaaatcgaagccctcgtccagcaactcgcccggctccccggcctcggc
ccgcgctcggcgcggcgcgcggtgctgcacctgatgaaaaagcgcgaaagtgcgttcgca
ccgctgctcgccgcgctgcaaaccgtgtccgaacggctcgtcacctgcacgacctgcggc
aatatcgacacgcacgacccctgcgcgatctgcgccgacccgcgccgcgatgcgcgcagc
ctgtgcgtcgtcgaggaggtgtcggacctgtgggcgctcgacaagtcgcggctcttcccc
ggcaaatatcatgtgctcggcgggcggctgtcggcgctggagggcgtgcggccgcaggat
ctcagcatcgacgcgctggtcacgcgcgtcgcggcgggcggcatcgacgaggtcgtgctc
gcaatgaatgcgacgctggagggccagacgaccgcccattatctcgccgagcggctggag
ggctatccggtgcggctgacgcagctggcgcatggtttgccggtgggcggcgagctcgat
tatctcgatgaggggacgctggcgcaggcgctgcgggcaagaaggccagtgggctga

DBGET integrated database retrieval system