KEGG   Sphingopyxis alaskensis: Sala_0499Help
Entry
Sala_0499         CDS       T00361                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sal  Sphingopyxis alaskensis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sal00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sal00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(517129..518412)
Genome map
AA seq 427 aa AA seqDB search
MDQIVIRGGQRLKGRIPISGAKNAALTLLPCALLTDEPLTLRNLPRLADVDGFGHLLNQL
GCSTTIEGSRPEDFGRVMTARATTLTSTVAPYDIVRKMRASILVLGPLLARAGEATVSLP
GGCAIGNRPIDLHLKALEAFGAEIELASGYVKAVAAGGRLAGGRFTFPVVSVGATENAVM
AAVLAKGTCVLENAAREPEIVDLCNCLVAMGAHIEGIGTETLTIEGVDRLHGATYRVMAD
RIEAGSYACAAVITEGDVELVGAKASEMEATLAALREAGATVEETKGGIRVAMAGRAQPV
TLSTAPYPGFATDMQAQFMAMATLGTGASLFTETIFENRYMHVPELARMGCDIQVKGRTA
VVRGVDRLIGAPVMATDLRASMSLIIAGLAAEGTTEVNRVYHLDRGYERLEEKLQAVGAD
IERISAG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaatcgtcattcgcggcggccagcgactcaagggccgtattcccatcagcggt
gccaagaacgccgcgctcacgctgctgccgtgcgcgctgctcaccgacgagccgctgacc
ttgcgcaacctgccgcggctcgccgacgtcgacgggttcgggcatttgctcaaccagctt
ggttgttcgacgacgatcgagggatcgcggcccgaggatttcggccgcgtgatgactgcg
cgcgcgacgacgctgacctcgaccgtcgcgccctatgacattgtgcgcaagatgcgcgcg
tcgatcctcgtgctcggcccgctgctcgcgcgcgcgggcgaggcgacggtgtcgctcccc
ggcggctgcgcgatcggcaaccgcccgatcgacctgcacctgaaagcgctcgaagccttt
ggcgccgagatcgaactggcgtcgggttatgtgaaggcggtggcggcgggcggacgtctt
gcgggcggcagattcaccttccccgtcgtgtcggtcggcgcgaccgaaaatgcggtgatg
gcggcggtgctcgccaagggcacgtgcgtgctcgaaaatgcggcgcgcgagcccgagatc
gtcgacctgtgcaactgccttgtcgcgatgggcgcgcatatcgagggcatcggcaccgaa
acgctgacgatcgaaggcgtcgaccgcctgcacggcgccacctatcgcgtgatggccgac
cgcatcgaggcgggaagctacgcctgcgccgcggtgattaccgagggcgacgtcgaactg
gtcggcgccaaggcgagcgagatggaagcgacgctcgccgcgctgcgcgaagcgggcgcg
acggtcgaggagacaaagggcggcatccgcgtcgccatggcgggccgcgcgcagccggtg
acgctgagcaccgcgccctaccccggcttcgccaccgacatgcaggcgcagttcatggcg
atggcgacgctcggcaccggcgcgtcgctgttcaccgaaacgatcttcgagaaccgctat
atgcacgttcccgagctggcgcgcatgggctgcgacatccaggtcaagggccgcaccgcg
gtggtgcgcggggtcgaccggctgatcggcgcgccggtgatggcgaccgaccttcgcgcc
tcgatgagcctgatcatcgccggactcgcggccgagggcacaaccgaggtgaaccgcgtc
tatcacctcgaccgcggttacgagcggctggaggaaaagctccaggccgtgggcgccgac
atcgagcggatcagcgcggggtag

DBGET integrated database retrieval system