KEGG   Sphingopyxis alaskensis: Sala_0620Help
Entry
Sala_0620         CDS       T00361                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
sal  Sphingopyxis alaskensis
Pathway
sal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sal00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sala_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrome-c551
Motif
Other DBs
NCBI-ProteinID: ABF52341
JGI: Sala0620
UniProt: Q1GVI1
Position
complement(631946..632389)
Genome map
AA seq 147 aa AA seqDB search
MRTAPVLLAGALLLAGCGKSDAPPTDDPVADSPATGESATDAPAVEPTAAMGEQIFRRCV
ACHTVDKGGRHGIGPNLHGIVGAPVAAKAGFSYSGAMKAKGGVWDEAALDAYLKAPMKDV
PGTRMAFAGVVDATDRKALILYLQAQK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccgcgcccgtcctgctggcgggcgcgctgctgctcgccggctgcggcaagagc
gacgcgccgccgaccgacgacccggtggccgacagcccggcgacgggcgagtcggcgacc
gacgcgcccgcggtcgaaccgactgcggcgatgggcgagcaaatcttccgccgctgcgtc
gcctgtcacaccgtcgacaagggcgggcgccacggtatcggcccgaatctgcacggcatc
gtcggtgcccccgtcgcggcaaaggcaggcttttcctattcaggcgcgatgaaggccaag
ggtggcgtgtgggacgaagccgcgctcgacgcctatctcaaagcgccgatgaaggacgtc
cccggcacgcgcatggcctttgcgggggtggtcgacgccaccgaccgcaaggcgctgatc
ctgtatctgcaagcgcagaaatag

DBGET integrated database retrieval system