KEGG   Sphingopyxis alaskensis: Sala_0700Help
Entry
Sala_0700         CDS       T00361                                 

Definition
lipolytic protein G-D-S-L
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sal  Sphingopyxis alaskensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sala_0700
Enzymes [BR:sal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sala_0700
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Sala_0700
Lipid biosynthesis proteins [BR:sal01004]
 Fatty acid synthase
  Component type
   Sala_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
707277..707990
Genome map
AA seq 237 aa AA seqDB search
MKTAGWRSALIYGCVFALCQPLAACGSAEAPPASTNDGKAAKAVPAIPADAPLVIAFGDS
LYAGYQLGPKEGLAPQLQAALAADGVVARVQNAGVSGDTSAAGRQRLTYVLDNAKVKPTL
IVLGLGGNDMLRGIGPDQTRANLDAMLAELQRRDIPVLLTGMMAAPNLGSDYADKFNAIF
PDLAAKYDVSFYPFILDNVVTNKALMLGDNLHPNAKGVKVVADALAPLVEQALPDAE
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggccggatggcggtctgccttgatatatggttgcgtcttcgcgctttgccaa
ccgcttgccgcctgcggctcggcggaggcgccaccggcatcgacgaacgacggaaaggcg
gcgaaagccgtccccgcgattcccgccgacgcaccgctcgtcattgcgttcggcgacagc
ctctacgccggttaccagcttgggcccaaagaaggactggcgccgcagcttcaggccgcg
ctcgccgccgacggcgtcgttgcgcgcgttcagaatgccggcgtgtcgggcgatacgagc
gccgcgggccgccagcggctgacctatgtgctcgacaatgcgaaggtgaagccgacgctc
atcgtgctggggctcggcggcaacgacatgctgcgtggcatcggccccgaccagacgcgc
gccaatctcgacgccatgctcgccgagcttcaaaggcgcgacattcccgtactgctcacc
ggcatgatggcggcgccgaaccttggcagcgactatgcggacaagtttaacgccatcttt
cccgatctcgccgcgaaatatgacgtaagcttctatcccttcatcctcgacaatgtcgtc
accaataaggcgctgatgctcggcgacaatctccatcccaatgccaagggcgtgaaggtc
gtggccgacgccctcgcgccgctcgtcgagcaggcgctgcctgacgcggaataa

DBGET integrated database retrieval system