KEGG   Sphingopyxis alaskensis: Sala_0736Help
Entry
Sala_0736         CDS       T00361                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sal  Sphingopyxis alaskensis
Pathway
sal00071  Fatty acid degradation
sal00280  Valine, leucine and isoleucine degradation
sal00281  Geraniol degradation
sal00310  Lysine degradation
sal00360  Phenylalanine metabolism
sal00362  Benzoate degradation
sal00380  Tryptophan metabolism
sal00410  beta-Alanine metabolism
sal00627  Aminobenzoate degradation
sal00640  Propanoate metabolism
sal00650  Butanoate metabolism
sal00903  Limonene and pinene degradation
sal00930  Caprolactam degradation
sal01100  Metabolic pathways
sal01110  Biosynthesis of secondary metabolites
sal01120  Microbial metabolism in diverse environments
sal01130  Biosynthesis of antibiotics
sal01212  Fatty acid metabolism
Module
sal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sala_0736
   00650 Butanoate metabolism
    Sala_0736
  Lipid metabolism
   00071 Fatty acid degradation
    Sala_0736
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sala_0736
   00310 Lysine degradation
    Sala_0736
   00360 Phenylalanine metabolism
    Sala_0736
   00380 Tryptophan metabolism
    Sala_0736
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sala_0736
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sala_0736
   00281 Geraniol degradation
    Sala_0736
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sala_0736
   00627 Aminobenzoate degradation
    Sala_0736
   00930 Caprolactam degradation
    Sala_0736
Enzymes [BR:sal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sala_0736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 CLP_protease
Motif
Other DBs
NCBI-ProteinID: ABF52456
JGI: Sala0736
UniProt: Q1GV66
Position
740966..741661
Genome map
AA seq 231 aa AA seqDB search
MTGAVSYFHENGVATITIDDGKVNVMTTDLLDELCRSITQARDDRSMILLRSGREKIFSA
GFDVKPLTSRDAEASRALLQAGINAILALLEYPYPVVSLCAGHAYPMGAFLLLASDARIG
VHGEYRVGMNEVAIGIAVPDFALHLAGYRVAPTWLHRVVALGRMLNPQEAVEAGFLDMLV
PPERVETALDQTIGHLAGLNMAAHASTKNRMRANVAEAIRTAGRDRLLPTG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcgcagtaagctactttcacgagaatggcgttgccacgatcacgatcgatgac
ggcaaggtgaatgtcatgacgacagacttgctggatgaactgtgccgttcaatcacccag
gccagggacgatcggtcgatgatcctgctccggtcaggtcgggagaagatcttctccgca
ggcttcgacgtcaagccactgaccagccgggatgcagaggcaagtcgcgctcttctgcaa
gcagggatcaatgcgatccttgcacttctggagtatccctatccggtagtcagcctttgt
gcaggacatgcttaccccatgggggcatttctgctgctcgcctcggacgcacggatcgga
gttcatggggaatatcgggtcgggatgaatgaggtggcgatcggtatcgccgtgcccgat
ttcgccttgcatcttgctggatatcgtgtggccccgacgtggcttcaccgagtggtcgcg
cttggtcgcatgctgaatccccaagaggcggtcgaagccggtttcctcgatatgctggtg
cctccggaacgggtcgaaacggcactggaccaaaccattgggcacctcgcgggcctgaat
atggcggcacatgcgtcaacaaagaaccggatgcgggccaatgttgccgaagcaatcaga
acggccggccgcgatcggctgttgccgaccggttga

DBGET integrated database retrieval system