KEGG   Sphingopyxis alaskensis: Sala_0835Help
Entry
Sala_0835         CDS       T00361                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sal  Sphingopyxis alaskensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sala_0835
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sala_0835
Enzymes [BR:sal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sala_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(841089..841874)
Genome map
AA seq 261 aa AA seqDB search
MNKLTQILATKATEVAERRALRSLADLDAIDAGPVRGFAAAVQAKIDAGGYGLIAEIKKA
SPSKGLIRKDFNPADHARAYAAGGAACLSVLTDAPWFQGHEDYLVAARAACALPVLRKDF
MIDPWQVAEARSIGADAILIIVAALDDGAMREIEAAAIERGMDVLVEVHDEAELDRALTQ
LQSRLIGVNNRDLRTFETDLGVTERLAKLVPADTLLVGESGIATHADCQRLADSGVRAFL
VGESLMRQADVTAVTRALLEG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaactcacccagatcctcgccaccaaggcgaccgaagtcgccgaacgccgcgcc
ctgcgctcgctcgccgaccttgatgcgatcgacgccgggccggtgcgcggctttgccgcc
gccgtgcaggcgaaaatcgacgccggcggctatggcctgatcgccgaaatcaagaaagca
tcgccatccaagggattgattcgcaaagatttcaaccccgccgatcatgcgcgcgcctat
gccgcgggcggcgccgcctgcctgtcggtgctcaccgacgcgccctggtttcaggggcat
gaggattatctggtcgccgcgcgcgccgcctgcgcgctgcccgtgctgcgcaaggatttc
atgatcgacccgtggcaggtggccgaggcgcggtcgatcggcgccgacgcgatcctcatc
atcgtcgcggcgctcgacgacggcgcgatgcgcgagattgaagcggcggcaatcgagcgc
ggcatggacgtgctggtcgaggtccatgacgaagccgaactggaccgcgcgctcacgcag
ctgcaatcgcgcctgatcggcgtcaacaaccgcgaccttcgcaccttcgaaaccgacctt
ggcgtcaccgaacggctggccaaacttgtccccgcggatacgctcctcgtcggcgaaagt
ggcatcgcaacccacgccgactgccagcgcctcgccgacagcggcgtccgggccttcctc
gtcggcgaaagcctgatgcgtcaggccgacgtcacggcggtaacaagggcgctgctcgaa
ggctga

DBGET integrated database retrieval system