KEGG   Sphingopyxis alaskensis: Sala_0966Help
Entry
Sala_0966         CDS       T00361                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sal  Sphingopyxis alaskensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sal00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
992319..993449
Genome map
AA seq 376 aa AA seqDB search
MFHPLTRADLGKTWEDARIYLRPTCFVDRPHELDDACLRIADTMVWFAAWHVSLRDNGAV
LSAIVPVAELDDWIAAMPGRLGEAAKAQRAGVARPRGNLQLGERTIRLSEPQLMGIVNVT
PDSFSDGGKHVDAGAAIDAGFAMGAAGAAIIDVGGESTRPGAPLIWEGDEIRRIEGVVSA
LAKGGVAVSIDTRKAAVMEAALAAGAGIVNDISALRYDERAMDVVVQAGCPVVLMHAPSA
KSDPHEGGTYAHVLFDVYDMLAERVAACVAAGVDRAKIIVDPGIGFGKGVGDNLALVNGL
ALFHTLGCPVLFGASRKRMIGALDNEAAADQRLGGTVALNYQAAAQGAQLLRVHDLAENR
QALRVWRGLRDAALTS
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgttccacccgctgaccagggccgacctcggcaagacatgggaggatgcccgcatctac
ctccgcccgacgtgcttcgtcgatcgcccgcacgaactggacgacgcctgcctgcggatc
gccgacacgatggtctggttcgcagcctggcacgtcagcctgcgcgataatggcgccgtc
ctttcggcgatcgtgccggtcgccgaactcgacgactggatcgcggcgatgccgggccgg
ctgggcgaagcggcgaaagcgcagcgcgcgggagtcgcgcggccgcgcggcaacctccag
cttggcgaacgcacgatccggttgagtgagccgcagctgatgggcattgtgaacgtgacg
cccgacagtttttcggacggcggcaagcatgtcgatgccggtgcggcgatcgacgcgggt
ttcgcgatgggcgcggcgggcgcggcgatcatcgacgtcggcggcgaatcgacgcggccc
ggcgcgccgctcatctgggaaggcgacgagatccggcgcatcgaaggggtggtttcggcg
ctggcgaagggcggtgtcgcggtgtcgatcgacacgcgcaaggccgccgtgatggaagcc
gcgctcgcggcaggcgccggcatcgtcaacgatatttcggcgctgcgttacgacgagcgc
gcgatggacgtggtggtgcaggcgggctgcccggtcgtgctgatgcacgcgccgtcggcc
aagagcgacccgcatgagggcggaacttacgcccatgtcctgttcgacgtgtacgacatg
ctcgccgagcgcgttgcggcgtgcgtggccgcgggggtcgaccgcgcgaagatcatcgtc
gatccgggaatcggcttcggcaagggggtgggcgacaatctggcgctcgtgaacggcctg
gcactgttccacacgctcggctgtccggtgctgttcggcgcgagccgcaagcggatgatc
ggcgcgctcgacaatgaggccgcggcggatcagcggctcggcggcacggtcgcgctgaac
tatcaggcggcggcgcaaggcgcgcagctgctgcgcgtccatgacctggcggaaaaccgt
caggccctgcgcgtgtggcgggggttgcgcgatgcggcgctgaccagttaa

DBGET integrated database retrieval system