KEGG   Sphingopyxis alaskensis: Sala_1064Help
Entry
Sala_1064         CDS       T00361                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sal  Sphingopyxis alaskensis
Pathway
sal00260  Glycine, serine and threonine metabolism
sal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sal01100  Metabolic pathways
sal01110  Biosynthesis of secondary metabolites
sal01130  Biosynthesis of antibiotics
sal01230  Biosynthesis of amino acids
Module
sal_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sala_1064
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sala_1064
Enzymes [BR:sal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sala_1064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABF52781
JGI: Sala1064
UniProt: Q1GU91
Position
complement(1097097..1098329)
Genome map
AA seq 410 aa AA seqDB search
MDMTMTDAPTLPNSLRSGPDDRGHFGRFGGRYVAETLMPLILDLERHYRAAQADPAFKAE
FDYLLKHYVGRPSPLWLAQRLTDDLGGAKIYLKREDLNHTGAHKINNCIGQILLAKRMGK
TKIIAETGAGQHGVATATVAALFGLPCTIFMGAVDVARQQPNVFRMKLLGAEVVAVTSGA
RTLKDAMNEALRHWVGHVHDTFYIIGTVAGPHPYPQLVRDFQSVIGDEAREQILEAEGRL
PDMLIAPVGGGSNAIGLFHPFLDDTDVEIVGVEAAGEGLDGKHAASLAGGKPGILHGNKT
YLLQDADGQITEAHSISAGLDYPGIGPEHSWLHDIGRVRYEPVTDAEALASFQKLTRLEG
IIPALESAHAIAAAERIAPTLGKDKIIIVNCSGRGDKDIATVADALGVKL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggatatgacgatgaccgacgccccgaccctgcccaacagccttcgctccggtcctgat
gatcgcggccatttcggccggttcggcggccgctatgtcgccgaaacgctgatgccgctg
atcctcgacctcgaacgccattatcgcgccgcacaggccgacccggcgttcaaggccgag
ttcgattatctgctgaaacattatgtcggtcgccccagcccgctgtggctggcgcagcgg
ctgaccgacgacctcggcggcgcgaaaatctacctcaagcgcgaggatctgaaccacacc
ggcgcgcacaagatcaacaattgcatcggccagatcctgctcgccaagcgcatgggcaag
accaagatcatcgccgaaaccggcgcgggccagcacggcgttgcgaccgcgaccgtcgcc
gcgctcttcggcctgccctgcaccatcttcatgggcgcggtcgatgtcgcgcggcaacag
cccaatgtgttccgcatgaagctgctcggcgccgaagtcgtcgctgtgacaagcggcgcc
aggacgctgaaggatgcgatgaacgaggcgctgcgccactgggtcggacatgtacacgat
actttctacatcatcggcaccgtcgccgggccgcacccctatccgcagctcgtccgcgat
ttccagtcggtgatcggcgacgaagcgcgcgaacagatactggaggcggagggccgcctc
cccgacatgctgatcgccccggtcggcggcggatcgaacgcgatcgggctgttccacccc
ttcctcgatgacacggacgtcgaaatcgtcggtgtcgaagccgcgggcgaagggctggac
ggcaagcacgccgcgagcctcgcgggcggaaaacccggcatccttcacggcaacaagacc
tatctgttgcaggacgcggacggccagatcaccgaagcgcacagcatctcggcaggcctc
gactatccgggcatcggccccgaacatagctggctccacgacatcggccgcgtccgctac
gagcccgtcaccgacgccgaggcgctggcaagcttccagaagctcaccaggctcgaaggc
attatcccggcgctggagtccgcccacgcgattgctgcggcagagcgcatcgcgccgacg
ctgggcaaggacaagatcatcatcgtcaattgctcggggcggggggacaaggatattgca
acggtcgcggatgcgttgggggtgaagctgtga

DBGET integrated database retrieval system