KEGG   Sphingopyxis alaskensis: Sala_1110Help
Entry
Sala_1110         CDS       T00361                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sal  Sphingopyxis alaskensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sala_1110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sala_1110
   00052 Galactose metabolism
    Sala_1110
   00500 Starch and sucrose metabolism
    Sala_1110
   00520 Amino sugar and nucleotide sugar metabolism
    Sala_1110
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sala_1110
   00524 Butirosin and neomycin biosynthesis
    Sala_1110
Enzymes [BR:sal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sala_1110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1145105..1146076
Genome map
AA seq 323 aa AA seqDB search
MREQIVTVDIGGTHARFAIAEIEGGRVRSLGEATTLHTKDHASFQTAWQDFEGRQGGTLP
RAVAIAIAGPTRGEIIRFTNNPWIIRPALIGEKLNVDRHILVNDFEAVGHAVAQADESYF
GRLTGPDEPLPATGTISVIGPGTGLGVAHIWRDESGYRVQATEGGHIDFAPLDSIEDAIL
ARLRKRHRRVSVERVVSGPGIVDIYETLAALEGRAVTPLDDKAIWAAALSGGDSLAAAAA
DRFCLSLGSVAGDLALAQGASGVVIAGGLGLRIRDSLVRSGFPERFIEKGRFEGFMAALP
VKLITHPQPGLFGAAAAFARQHG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaacagatcgtcacggtcgatattggcggcacgcacgcccgttttgctatcgcc
gagatcgagggtgggcgcgtccgttcgctgggcgaagcgacgacgctgcatacaaaggat
catgcgagcttccagacagcgtggcaggatttcgaaggccggcaaggcggcaccctgcca
cgcgcggtcgcgatcgcgatcgccggcccgacgcgcggcgaaatcatccgcttcaccaac
aatccgtggattatccgtcccgcgctgatcggcgaaaagctgaatgtcgaccgccatata
ctcgtcaatgatttcgaggcggtgggccatgccgtcgcgcaggccgacgagagctatttc
gggcggctgaccggccccgacgagccgctgccggccaccggcacgatcagcgtcatcgga
cccggcaccgggcttggcgtcgcgcatatctggcgcgatgagagcggctatcgcgtgcag
gcgaccgagggcgggcatatcgacttcgcaccgctcgacagcatcgaggacgcgatcctc
gcgcggctacgcaagcggcaccgccgcgtatcggtcgagcgcgtcgtgtctggccccggc
atcgtagacatttacgaaacgctcgccgcactcgaaggacgcgcggtgacaccgctcgac
gacaaggcgatctgggccgctgcgctgagcggcggggacagtcttgccgcggcggctgcc
gatcgcttctgcctctcgctcggcagcgtcgcgggtgatctcgcgctggcgcagggggcg
agcggggtggttatcgcgggcggtctgggtctgcgcattcgcgatagcctggtgcgatcg
ggctttccggaacgctttatcgaaaaggggcggttcgaggggttcatggcggcgctgccg
gtaaagctcatcacgcatccgcagccggggctgttcggcgctgcggctgcctttgctcgc
cagcatggctga

DBGET integrated database retrieval system