KEGG   Sphingopyxis alaskensis: Sala_1140Help
Entry
Sala_1140         CDS       T00361                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sal  Sphingopyxis alaskensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sala_1140
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Sala_1140
Enzymes [BR:sal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sala_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1178013..1179020
Genome map
AA seq 335 aa AA seqDB search
MIPAIFGLSGLTLTDDERAFFRDCAPAGYILFGRNIENRDQLRRLTDELRSLDGRANLPI
LIDQEGGRVARMKEPEWPAFPSGAAFDALYERAPASAIEAARLNAMALAAMLAEVGITVD
CLPLLDVRQPGASDVIGDRALGSEPMRVAALGRAILSGLQAGGVVGIVKHIPGHGRALLD
THEALPTVTASDRELQTDLAPFAALRDAAMAMTCHVIFAAWDPDRPATLSPTVIDSVIRQ
RIGFHGLLMTDDLDMKALSGNVPSRAAQAIAAGCDIALNCWARMDDMIGIANRLDPISTV
SRARLEGAMDRIAGARDEGEFAALVDQRDALLAMV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgattcccgcgattttcggcctgtccgggctgaccctgaccgacgatgaacgagccttt
tttcgcgattgcgcgcccgcgggctatatcctgttcggacggaatatcgaaaaccgcgac
cagctccgccgcctgaccgacgagttgcgcagcctcgacgggcgggccaatctgccgatt
ctgatcgatcaggagggcggccgggtcgcacgcatgaaagaacccgaatggcctgctttc
cccagcggggcggcctttgacgcgctttatgagcgcgcgcccgccagcgcgatcgaggcg
gcgcggctcaatgccatggcgctcgcggcgatgctcgccgaagtcggcatcacggtcgat
tgcctaccgctgctcgacgtgcgccagccgggcgcgagcgacgtgatcggcgaccgcgcg
ctcggcagcgagccgatgcgcgtcgccgcgctcggccgcgccattctgagcggtttgcag
gcgggcggcgtcgtcggcatcgtcaaacatatccccggccacggccgcgcgctgctcgac
acgcacgaagccctgccgacggtcaccgcctccgaccgcgaactgcagaccgatcttgct
ccgttcgcggcgctccgcgatgcggcgatggcgatgacctgtcacgtcatttttgcggcg
tgggatcccgaccggcccgcgaccctgtcgccgaccgtcatcgacagcgtgatccgccag
cggatcggtttccatgggctgctgatgaccgacgatctcgacatgaaggcgctgtcgggc
aacgtgccctcgcgcgcggcgcaggcgatcgcggcagggtgcgacatcgcgctcaattgc
tgggcgcggatggatgacatgatcggcatcgccaaccggctcgatccgatcagcacggtc
tcgcgcgcgcggcttgaaggcgcgatggaccggatcgcgggcgcgcgtgacgaaggcgag
ttcgccgcgctcgtcgatcagcgcgatgcgctgctggcgatggtctga

DBGET integrated database retrieval system