KEGG   Sphingopyxis alaskensis: Sala_1172Help
Entry
Sala_1172         CDS       T00361                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sal  Sphingopyxis alaskensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sala_1172
   01230 Biosynthesis of amino acids
    Sala_1172
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sala_1172
   00051 Fructose and mannose metabolism
    Sala_1172
   00562 Inositol phosphate metabolism
    Sala_1172
Enzymes [BR:sal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sala_1172
Exosome [BR:sal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sala_1172
  Exosomal proteins of bladder cancer cells
   Sala_1172
  Exosomal proteins of melanoma cells
   Sala_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1206815..1207561)
Genome map
AA seq 248 aa AA seqDB search
MTRRKYVVGNWKMNGLKEALGEARAIFAAADTHPGVDVALCPPFTLIGAMAAAAPGKAIG
GQDCHSAASGAFTGSVAAPMLADVGASLVIVGHSERREGCGESDADVRAKAEAALAAGLS
VILCVGEPRSVRESGGAIDHVLAQVAESVPDALDPQRFAIAYEPIWAIGTGLVPTVADVA
AMHGAIRSALADRFGDAAQAIRILYGGSVNGDNAAELLDTGDVDGALVGGASLTAAKFVP
IIEAAAGL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggcgcaaatatgtggtcggcaactggaagatgaacgggctgaaggaggcgctc
ggcgaagcccgggcgatttttgccgccgccgatacgcaccccggcgtcgacgtcgcgctg
tgcccgcccttcacattgatcggcgcgatggccgcggcagcgccgggcaaggcgatcggc
ggacaggattgccacagcgccgcgtcgggcgccttcaccggctcggtcgcggcgcccatg
cttgccgacgtcggcgcgtcgcttgtcatcgtcgggcacagcgaacggcgcgagggttgc
ggcgaaagcgacgccgatgtgcgcgcgaaggccgaggcggcgctcgccgcgggcttgtcg
gttatcctctgcgtcggcgaaccgcgcagcgtacgcgagtcgggcggcgcgatcgaccat
gtgctggcgcaggtcgcggaatcggtgccggacgccctcgatccgcagcggtttgccatc
gcttatgagccgatctgggcgatcggcacggggctggtcccgaccgtcgccgacgtcgcg
gcgatgcacggcgcgatccgcagcgcgctggccgaccgtttcggcgacgccgcacaggca
atccgcatcctctatggcggctcggtcaatggtgacaatgccgccgaactgctggatacc
ggcgacgtcgacggtgcgctcgtcggcggcgccagcctgaccgccgcgaagttcgtgccg
atcatcgaggccgcggccggactttaa

DBGET integrated database retrieval system