KEGG   Sphingopyxis alaskensis: Sala_1187Help
Entry
Sala_1187         CDS       T00361                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sal  Sphingopyxis alaskensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sal00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1227605..1228456
Genome map
AA seq 283 aa AA seqDB search
MSATMRETGWAKINLALHVRARRADGYHDIETLFAFVDGGDTIEAALAATDTLVIDGEFA
EGLSSGADNLVLRVLALLRARYGADRVPPLAVRLTKRLPLAAGIGGGSADAAAMARLVRT
HFLPELGDATLARIVGPLGADIAACVASTTCMGSGTGEDLHAVAGLRIAGVPVLLVNPRQ
PVATGPVFAAWDGIDRGPLYIGTDYRAQLIGARNDLQRPALAACPAISDILLELGALRPW
LARMSGSGATCFALFDAAADRDAAKAVLAARHPGWWLMAGALR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccacgatgcgggagacgggctgggccaagataaaccttgcgctccacgtccgc
gcgcggcgcgccgacggctatcacgatattgaaacgctgtttgccttcgtcgatggcggc
gatacgatcgaagccgcccttgccgccaccgacacgcttgtcatcgacggtgagtttgcc
gaaggcctgagttcgggcgccgacaatctggtgctgcgcgtacttgcgctgctgcgcgca
cgctatggcgccgatcgcgtgccgccgctcgcggtaaggctgacgaagcgtttgccgttg
gcggcggggatcggcggcggctccgccgatgccgcggcgatggcgcggctggtccgcacg
catttccttcccgaactgggtgatgcgacgctcgcgcgcatcgtcggtccgctcggtgct
gatattgccgcctgcgtggcgagcacgacctgcatgggttcggggaccggcgaggatctg
cacgccgtcgcgggtctgcggatcgcgggcgtaccggtgctgctggtcaatccgcgccag
cccgtcgcgacagggccggtctttgccgcgtgggacgggatcgaccgcgggccgctctac
attggcacggactaccgggcgcagttgatcggcgcgcgcaacgatttgcagcgccccgcg
ctcgccgcctgccctgcgatttccgacatattgcttgaactcggcgcgctgcgaccgtgg
ctcgcgcgcatgtcgggatcgggagcgacctgcttcgcgctgttcgatgcggcggccgac
cgcgacgcggcaaaggcagtgctcgccgcacggcatccgggatggtggctgatggcaggc
gcgctgcgatga

DBGET integrated database retrieval system