KEGG   Sphingopyxis alaskensis: Sala_1235Help
Entry
Sala_1235         CDS       T00361                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sal  Sphingopyxis alaskensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:sal01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sal00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sal00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sal00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1283738..1285048
Genome map
AA seq 436 aa AA seqDB search
MPIELKMPALSPTMEEGTLAKWLVKEGDEVKSGDLLAEIETDKATMEFEAVDEGVISQIL
VAEGTDGVKVGTVIAVIAGEGEDAGEAKATPAAAPAPVPAKDVAPAEAGAATVSAPPPAV
LASAGTTNVGDRIKASPLARRLAAEQGIDLKKLTGTGPGGRIVKADLEGAPTGAAASTAV
APAQAGAAVGTAPAAAPEPAGPIPDFGIPHEDEKLSGMRKTIARRLSQSMQDAPHIYLTV
DIRLDALLKLRGELNASLESRGVKLSVNDMLIKALAVALERVPQCNVSFGGDVMRFYKRA
DISVAVSIPGGLITPIITDAGAKSLSKISTEMAELAGRAKEGKLQPHEYQGGTASISNMG
MMGIKQFTAVINPPQAMIMAIGAGEKRPYVVDDALAIATVMSATGSFDHRAIDGADGALL
MKTFKELVESPLGLVA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcgaactcaagatgcccgctctctcgccgacgatggaggagggcacgctcgcc
aaatggcttgtgaaggagggcgatgaggtcaagtcgggcgacctgctcgccgagatcgaa
accgacaaggcgacaatggagttcgaagcggtcgatgagggtgtgatcagccagatactc
gtcgccgaggggaccgacggcgtgaaggtcggcacggtgatcgcggtgatcgcgggcgag
ggggaggatgcgggcgaagcgaaggcgacgcctgctgctgcgcctgcgccggttccggca
aaagacgtcgccccagcggaagctggggccgctaccgtcagtgcacctccgccagcggtc
ctagcttccgctgggacgacgaatgtgggcgaccgcatcaaagccagcccgctcgccagg
cgcctcgctgccgagcaaggcatcgacctcaaaaagctgaccggcaccggccccggcggc
cgcatcgtcaaggccgaccttgaaggcgcgcccacaggcgccgctgcatccactgccgtc
gcccccgcgcaggcgggggccgctgtcggcacggcgcccgctgccgcaccggaaccggcc
ggcccgatccccgatttcggcatcccgcatgaggatgaaaagctgtcggggatgcgcaag
acgatcgcgcgccgcctgagccagtcgatgcaggacgcgccgcacatctacctcaccgtc
gacatccgcctcgacgcgctgctcaagctccgcggcgagcttaacgcgagcctggagagc
cgcggggtcaagctgagcgtcaacgacatgctgatcaaggcgctcgcggtcgcgctcgag
cgcgtcccgcagtgcaacgtcagctttggcggcgacgtgatgcgcttttacaagcgcgcc
gacatttcggtcgcggtcagcatccccggcggcctcatcaccccgatcatcaccgatgcg
ggggccaagtcgctgtcgaaaatctcgaccgaaatggccgagctcgcgggccgcgccaag
gaaggcaagctgcaaccgcacgaatatcagggcggcaccgccagcatctcgaacatgggc
atgatggggatcaagcagttcaccgcggtgatcaacccgccgcaggcgatgatcatggcg
atcggcgcgggcgaaaagcggccctatgtcgtcgacgatgcgctggcgatcgcgacggtc
atgtcggcgaccggcagcttcgaccaccgcgcgatcgacggggcggacggggcgctcttg
atgaagacgttcaaggaactggtggaaagcccgctggggctggtggcgtaa

DBGET integrated database retrieval system