KEGG   Sphingopyxis alaskensis: Sala_1394Help
Entry
Sala_1394         CDS       T00361                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sal  Sphingopyxis alaskensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1449079..1450170
Genome map
AA seq 363 aa AA seqDB search
MGWLGLRRARGTASDGGYPPPDPGGPRDLAREARYELAASITSFLVDNDLEVSPTNLLIA
HGAFSGCNPRLAQLIVARAQSPQGITQKWLDELEEQESGQPDRAELDKLMTRLEANLDAF
HANTKQARSATSDYGVELEQHVSDLEQLQKTGRIVSSLADLAKVMLERTRKAEEDMRKSE
DEAKALRRSLDRARRDAELDYLTGLPNRRAFENLLDRHYREARAALEPLSVAFCDIDEFK
KVNDTHGHDAGDRVIKAIADTLARISDDKCHVARHGGEEFVMLFRGLTPTEAAQKLDDAR
EALADRRLINRKTDEPFGQITFSGGVADVFGYGDARAALKAADAALYKAKTSGRNCIRIA
DPA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggttggctggggctccgccgcgcgcgcgggactgcctccgatggcggatatccgccc
cccgaccctggaggcccgcgcgacctggcgcgcgaggcacgctatgaactcgccgcatcg
atcacctctttcctcgtcgacaacgacctcgaagtctcgccgacgaacctgctcatcgcg
cacggtgccttttcgggatgcaacccccggctcgcgcagttgatcgtcgcgcgcgcgcaa
agtccgcagggcatcacccagaaatggctcgacgaactggaagaacaggaaagcggacag
cccgaccgcgctgaactcgacaagctgatgacgcggctcgaggcgaacctcgacgccttt
catgccaatacgaagcaagcgcgttccgccacgagcgattacggggtcgagctcgaacaa
catgtctccgacctcgaacagcttcagaaaacgggccgcatcgtctccagcctcgccgac
ctcgccaaggtcatgctcgaacgcacgcgcaaggccgaagaggatatgcgcaagagcgag
gatgaggcgaaagcgctgcgccgcagtctcgaccgcgccaggcgcgacgccgaactcgac
tatctgaccggcctgcccaaccgccgcgcattcgaaaatctgctcgaccggcattacagg
gaagcgcgcgccgcgctcgagccgctgagcgtcgccttctgcgacatcgacgagttcaag
aaggtcaacgacacgcacggccatgacgccggcgaccgcgtcatcaaggcgatcgccgat
acgctcgcgcgcatctccgacgacaaatgccacgttgcccgccatggcggcgaggagttc
gtgatgctgttccgcggcctgacgccgaccgaggccgcgcaaaagctcgacgatgcacgc
gaggcactcgccgaccggcggcttatcaaccgcaagaccgacgagcccttcggtcagatc
accttttcgggcggcgtggccgatgtcttcggctatggcgatgcgcgcgccgcgctgaag
gccgccgacgcggcgctttacaaggccaagacgagcggccgcaattgcatccgcatcgcc
gatccggcctga

DBGET integrated database retrieval system