KEGG   Sphingopyxis alaskensis: Sala_1398Help
Entry
Sala_1398         CDS       T00361                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sal  Sphingopyxis alaskensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sala_1398
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sala_1398
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sala_1398
Enzymes [BR:sal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sala_1398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1453095..1454492)
Genome map
AA seq 465 aa AA seqDB search
MDYISTRGSAPTLDFRAATLAGLASDGGLYVPTKWPRMSADEIRALAGLDYVETAVRIMR
PFVESVLTEDELRALCRAAYGRFSHDAVTPLVQLDHRHWLLELFHGPTLAFKDVALQLLG
ELFETFLSGGGTDITIVGATSGDTGSAAIEAVAGREHIQIFMLHPEGRVSDVQRRQMTTV
LAPNVHNIAIDGSFDDAQAMVKRLFGDEAARGQVNLSAVNSINWARLMAQIVYYFYAAVR
LGGPDRPVAFSVPTGNFGDVFAGYVAAQMGLPIARLVVATNVNDILHRALTSGDYSAGTV
TPTATPSMDIQVSSNFERLLFDLAGRDGAAIAGMMAEFEAKRAMTIPADMLAGARDLFSS
ARIDGDAMALALRWARERGGQIIDPHSAVGLAAARALEIDAEIPVVTLATAHPAKFREAV
ERATGVRPPLPARLGNLFEREERYTKLPGDYDVVKAFILAEAARG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggactatatcagcacccgcggctcagcgccgaccctcgactttcgtgccgccacgctc
gcgggccttgccagcgacggcgggctctatgtgccgaccaaatggccgcggatgtcagca
gatgaaatccgcgcgctcgcaggcctcgattatgtcgaaaccgcggttcgcatcatgcgg
cccttcgtcgaaagcgttttgaccgaggacgaactgcgcgcgctgtgccgggccgcctat
ggccggttcagccacgatgcggtgacgccgctggtccagctcgatcatcgccactggctg
ctcgaactcttccatgggccgacgctggcgttcaaggacgtcgcgctgcaattgctcggc
gaattgttcgagacgttcctgagtggcggcggcaccgacatcacgatcgtcggcgcgacc
tccggcgacactggatcggcggcgatcgaggccgtggcggggcgtgaacatatccagata
ttcatgctgcatccggagggccgcgtcagcgacgtgcagcggcgccagatgacgacggtg
ctcgcgcccaacgtccacaatatcgcgatcgacggcagcttcgacgatgcgcaggcgatg
gtgaagcggctgttcggcgacgaagcggcgcggggccaggtcaatctgtcggcggtgaac
agcatcaactgggcgcggctgatggcgcagatcgtctattatttctatgccgccgtccgc
ctcggcggacccgaccgcccggtggcgttcagcgtaccgacgggcaatttcggcgatgtg
ttcgcgggctatgtcgcggcgcagatgggcttgccgatcgcaaggctcgtcgtcgccacg
aacgtcaacgacatcctccaccgcgcgctgaccagcggcgattacagcgcggggacggtg
acgcccaccgcgacccccagcatggacattcaggtcagcagcaatttcgaacggctgctc
ttcgatctcgcgggccgcgacggcgcggccattgcggggatgatggccgagttcgaggcg
aagcgcgcgatgaccatccccgccgacatgctggccggcgcgcgcgacctgttttcgagc
gcgcgcatcgacggcgacgcgatggcgctcgcgctgcgctgggcgcgggaacgcggcgga
cagatcatcgacccgcacagcgcggtgggcctcgccgcggcgcgcgcgctggagatcgac
gccgagattccggtcgtcacgctcgcgacggcgcatccggccaagttccgcgaggcggtc
gagcgcgcgaccggggtacgcccaccactgcccgcgcggctgggcaatctgttcgagcgc
gaggaacgctatacgaagcttcccggcgactatgatgtcgtcaaggccttcatcctcgcg
gaagccgcgcgtggctga

DBGET integrated database retrieval system