KEGG   Sphingopyxis alaskensis: Sala_1625Help
Entry
Sala_1625         CDS       T00361                                 

Definition
twin-arginine translocation pathway signal
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sal  Sphingopyxis alaskensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sala_1625
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sala_1625
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sala_1625
Enzymes [BR:sal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sala_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1703813..1705378
Genome map
AA seq 521 aa AA seqDB search
MYNRRHFLAGATLAGLAAPAIVRAQGILRDFPFQLGVAAGDPASDGFVIWTRLAPEPMER
HGGMPLTNVPVEWEVASDGGFRDVVAKGTALARPELAHSVHVEVAGLQPDRPYYYRFTAA
GERSLRGRARTLPAPGARVDALTFGVAGCQHFESGFYGAYRHMAREDLAFVYHYGDFIYE
YRQDYLFDDGLPIRPVRQYAQRALFDLTDFRTAYAQTLLDIDQQAVRSVHAHLSSFDDHE
IRNNWVSDHDNWKLGLDKEDPDAASPEIFMLKKQAAMQAWYEHMPVRRSLLPRGGMVAAH
RELRYGDLMAMQLLDTRQYRDDQPCGDGFKPACPDVFARDRQVLGKVQEEWLARNLARGG
ATWNALAQQVTMMSLDRRRRPEESEKIVNLDSWAGYEVARTRMLSRFAGLNNNIVLTGDE
HQNFCGDLVLKDKVVGAEFVATSISSGGDGSDKRVGTDEWLARNPELKFANDQRGYLVCE
VNREAWQTHFMVVDKVSTPVNSLSKRATGVVERGVAGVKMA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccgccgccatttccttgccggagcgacgctcgccgggcttgccgcgccggcg
atcgtccgcgcgcagggtatcttgcgcgactttccctttcagcttggcgtcgcggcgggc
gacccggcgagcgatggtttcgtcatctggacgcgcctcgcgcccgagccgatggagcgc
cacggcgggatgccgctgaccaatgtgccggtcgaatgggaggtcgccagcgacggcggc
tttcgcgacgtggtggcaaagggcaccgcgctggcgcgccccgagctggcgcacagcgtc
catgtcgaggtcgcgggattgcagcccgatcgcccctattattaccgtttcaccgccgcg
ggcgaacgcagcctgcgcgggcgcgcgcggacgcttcccgcgcccggcgcgcgtgtcgat
gcgctgacgttcggcgtcgcgggatgccagcatttcgagtcgggcttttacggcgcctat
cgccacatggcgcgcgaggatctggccttcgtctatcattatggcgatttcatctatgaa
tatcggcaggattatctgttcgacgacgggctgccgatccgcccggtgcgccaatatgcg
caacgcgcgctgttcgacctgaccgatttcagaactgcctatgcgcagaccctgctcgac
atcgaccagcaggcggtgcggtcggtccacgcgcatctgtcgagcttcgacgatcacgag
atccgcaacaattgggtgtccgaccacgacaattggaaattggggctcgacaaggaagac
cccgatgctgcgtcgcccgagattttcatgctcaagaaacaggcggcgatgcaggcgtgg
tacgaacatatgcccgtgcgccggtcgctgttgccacgcggcggcatggtcgcggcgcac
cgcgagctgcgttatggcgacctgatggcgatgcaattgctcgacacgcggcaatatcgc
gacgaccagccatgcggcgacggcttcaaacccgcctgccccgacgtgttcgccagggac
cggcaggtgctcggcaaggtgcaggaggaatggctggcgcgcaatctggcgcgcggcggc
gcgacgtggaacgcgctggcgcagcaggtgacgatgatgtcgctcgaccggcggcggcgg
cccgaagagagtgaaaagatcgtcaacctcgacagctgggcaggttatgaggtggcgcgg
acgcggatgttgtcgcgctttgcggggctgaacaacaatatcgtgctgaccggcgacgag
catcagaatttctgcggcgatctggtgctgaaggacaaggtcgtcggcgccgagtttgtc
gcgacatcgatctccagcggcggggacggcagcgacaagcgcgtcggcaccgacgaatgg
ctggcgcgcaatcccgaactcaaattcgccaacgaccagcgcggttatctggtctgtgag
gtcaatcgcgaggcgtggcagacgcacttcatggtcgtcgacaaggtctcgacgccggtg
aacagcctgtcgaaacgcgcgacgggcgtggtcgaacgcggcgttgcgggcgtgaagatg
gcgtaa

DBGET integrated database retrieval system