KEGG   Sphingopyxis alaskensis: Sala_1737Help
Entry
Sala_1737         CDS       T00361                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sal  Sphingopyxis alaskensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sal00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sala_1737
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sala_1737
Enzymes [BR:sal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sala_1737
Two-component system [BR:sal02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Sala_1737
Bacterial motility proteins [BR:sal02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sala_1737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1829693..1830805)
Genome map
AA seq 370 aa AA seqDB search
MALAQPLVPDPDPPARTVRVMLVDDSLVVRSILERIVETRPGLHICASVASASDALDYLA
RETVDVVVLDIEMPGMNGIDALPHILERAAQARVLILSSNCVEGGPAAVEALALGASDTL
AKPGRGSFSGRFAEVLTDRILTLGNQREFPAPVPVAQRRARAPVSMVVDTDQPIDCIAVA
ASTGGIPAFTSFLANLDPRVTAPILLTQHLPDAFMAFYARQIGMMTTRRVHVAAAGMAVE
PGHIYLAPGDAHLIVIANGARREIALDRRPADNGCCPSADPMLDSVAETYGKSGVAVILS
GMGRDGAAGAARVKSAGGTVFAQAPESCVIWGMPGAVAKAGIAAATLNPDAIALMLGSFL
PGRAEGRPQP
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgcgcaacccctggttcccgatcccgatccgccggcgcggacggtgagggtg
atgctggtcgacgacagcctggtcgtgcgcagcatcctcgagcgaatcgtcgaaacgcgg
ccgggcttgcatatctgcgcatcggtcgcttcggcgtccgacgcgctcgattatctggcg
cgcgaaacggtcgacgtcgtggtgctcgacatcgaaatgccggggatgaacggcatcgat
gcgctgccgcacatcctggagcgcgcggcccaggcgcgcgttctgattctctcctcaaac
tgtgtcgagggcggtcccgcggcggtcgaggcgctggcgctcggcgcgagcgacacgctc
gcgaaaccggggcgcggcagcttttcgggccgctttgccgaggtgctgaccgaccgcatc
ctgacgctcggcaaccagcgcgagtttccggctcccgtgcccgtcgcgcagcggcgcgcg
cgcgcgccggtctcgatggtcgtcgataccgaccagccgatcgattgcatcgcggtcgcc
gcctcgacgggcggcattccggcctttaccagcttccttgccaatctcgacccgcgggtg
accgcgccgatcctgctgacgcagcatctgcccgacgccttcatggcgttttatgcgcgg
cagatcggcatgatgacgacgcggcgcgtccatgtggcggccgccggcatggcggtcgag
ccggggcatatctatctggcgccgggcgacgcgcatctgatcgtgatcgccaatggcgcg
cgccgcgaaatcgcgctcgatcgccgccccgccgacaacggttgctgcccgtcggccgac
ccgatgctcgattcggtggccgaaacctatggtaagagcggtgtcgccgtgatcctgagc
gggatgggacgcgatggggcggcgggcgcggcgcgggtcaagtcggcgggcggcacggtc
tttgcccaggcccccgaaagctgcgtgatctggggaatgcccggcgcggtcgccaaggcg
gggatcgccgcggcgacgctcaaccccgacgcgatcgcgctgatgctgggcagcttcctg
ccgggtcgcgccgaggggcgaccgcagccatga

DBGET integrated database retrieval system