KEGG   Sphingopyxis alaskensis: Sala_1760Help
Entry
Sala_1760         CDS       T00361                                 

Definition
(GenBank) DNA polymerase III chi subunit, HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sal  Sphingopyxis alaskensis
Pathway
sal00230  Purine metabolism
sal00240  Pyrimidine metabolism
sal01100  Metabolic pathways
sal03030  DNA replication
sal03430  Mismatch repair
sal03440  Homologous recombination
Module
sal_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sala_1760
   00240 Pyrimidine metabolism
    Sala_1760
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Sala_1760
   03430 Mismatch repair
    Sala_1760
   03440 Homologous recombination
    Sala_1760
Enzymes [BR:sal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Sala_1760
DNA replication proteins [BR:sal03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Sala_1760
DNA repair and recombination proteins [BR:sal03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Sala_1760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABF53473
JGI: Sala1760
UniProt: Q1GS99
Position
complement(1854793..1855242)
Genome map
AA seq 149 aa AA seqDB search
MPRVDFYRLTRDPVERVLPALAARVLGNGDRLLVVAAAAMQRQDIDAALWTANPASFLPH
GHAGTPDEAIEPILLSGTLDTSPPNGASRLALADGEWREDALAFDRTFFLFDNSRIDDAR
ATWRALAARDDVDNRFWKQDENGRWSEGP
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgtcgacttctaccgcctgacccgcgatcccgtcgaacgggtgctccccgcg
cttgcggcgcgcgtcctgggcaatggcgaccgcctgctggtggtcgccgccgcggcgatg
cagcggcaggacatcgacgcggcgctgtggaccgcaaaccccgcgagctttctgccgcac
ggtcatgcgggcactcccgacgaagcgatcgagccgatcctgctgtcgggcacgctggac
acttcgccgcccaatggtgccagccgccttgcgctcgccgacggcgaatggcgcgaagac
gccttggcgttcgatcgcaccttcttcctcttcgacaacagccgcatcgacgatgcgcgc
gccacctggcgggcgctggcggcgcgcgacgatgtcgacaaccgcttctggaaacaggat
gaaaacggtcgctggtccgaagggccatag

DBGET integrated database retrieval system