KEGG   Sphingopyxis alaskensis: Sala_1811Help
Entry
Sala_1811         CDS       T00361                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sal  Sphingopyxis alaskensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sal01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sal00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sal00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sal00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:sal00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1907951..1909915
Genome map
AA seq 654 aa AA seqDB search
MSDLPPSEPMVPVPADAAANTHCSAADYDRLYAASIADPDAFWAEQAKRLDWIKAPTRIA
GWSYDPVSIKWYEDGVLNLCHNAVDRHVAADHGDRTAIIFEPDAPDGETRHISYAALLAD
VVRFANTLKKMGVRKGDRVTIYMPMIPEGAVAMLACARIGAVHSVVFGGFSPEAIHGRIE
DCGSDWVICADEGLRGGKTVPLKANVDKALERIAVRGVLVIAHTGGEVNMTEGRDHWYDA
LSADVSADCPCEPMGAEDPLFILYTSGSTGKPKGVLHTVGGYSVWTATTFWYGFDYRPGE
IFWCSADIGWVTGHSYVVYGPLQNGATTLMFEGVPNYPDHDRFWQVVDKHGVNILYTAPT
AIRALMREGDDYVTRHDLSSLRLLGSVGEPINPEAWRWYHQIVGKGRVPVIDTWWQTETG
GIMITTLPGAHPMQPGSAGRPFFGIRPQLVDADGAVLVDEQTGGAAEGNLCITHSWPGQA
RTVYGDHDRFVQTYFSTYKGKYFTGDGCRRDASGYWRITGRVDDVINVSGHRMGTAEVES
ALVLHEDVAEAAVVGFPHDIKGQGIYAYVTLNAGVEPGEDIVAALKQQVRKEIGPIATPD
HIHLTPALPKTRSGKIMRRILRKIAENDFGSLGDTSTLADPGLVDGLIEERRNR
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacctacccccctccgaacccatggtccccgtccccgccgacgccgccgccaac
acgcattgcagcgctgccgactatgaccgcctctatgccgcgagcatcgccgaccccgac
gccttctgggccgagcaggcgaaacggctcgactggatcaaggcgccgaccaggatcgcg
ggctggtcctatgacccggtgagcatcaaatggtatgaggacggcgttctcaacctctgc
cacaacgccgtcgaccgccatgtcgccgccgaccacggcgaccgcaccgcgatcattttc
gagcccgacgcgcccgacggcgaaacgcggcatatcagctatgccgcgctgctcgccgac
gtcgttcgcttcgcgaacacgctcaagaaaatgggcgtgcggaagggcgaccgcgtcacc
atctatatgccgatgatccccgagggcgcggtggcgatgctcgcctgcgcgcgcatcggc
gcggtgcacagcgtcgtcttcggcggcttctcccccgaagcgatccacggccgtatcgag
gattgcggcagcgactgggtgatctgcgccgacgaggggctgcgcggcggtaagaccgtg
ccgctgaaagccaatgtcgacaaggcgctcgaacgaatcgcggtcaggggtgtgctcgtc
atcgcgcacaccggcggcgaggtgaacatgaccgaagggcgcgaccattggtatgatgcg
ctctcggccgacgtgtccgccgattgcccctgcgagccgatgggcgccgaagacccgctc
ttcatcctctatacctcgggatcgacgggcaagcccaagggtgtgctccacaccgtcggc
ggttacagcgtctggacggcgacgaccttctggtacggtttcgactatcggccgggcgag
attttctggtgcagcgccgacatcggctgggtcaccggccacagctatgtcgtttacggt
ccgctccagaatggcgcgacgaccctgatgttcgagggcgtccccaattatcccgaccat
gaccgcttctggcaggtcgtcgacaagcatggcgtcaacatcctctacaccgcaccgacc
gcaatccgcgcgctgatgcgcgagggcgacgattatgtcacgcggcacgacctgtcgtcg
ctccgcctgctcggcagcgtcggcgagccgatcaacccggaggcgtggcgctggtatcac
cagattgtcggcaagggccgcgtccccgtcatcgacacctggtggcagaccgaaaccggc
gggatcatgatcaccaccttgcccggcgcgcatccgatgcagccgggcagcgcgggacgc
ccctttttcggcatccgtccgcagctcgtcgatgccgatggcgcagtgctcgtcgacgaa
cagaccggcggcgcggcggagggcaatctttgcatcacccacagctggccgggacaggcg
cgcaccgtctatggcgaccatgaccggttcgtgcagacctatttttcgacctacaagggc
aaatatttcaccggcgacggctgccgccgcgacgcgagcggttattggcggattacgggg
cgtgtcgatgacgtgatcaatgtgtcggggcaccgcatgggcaccgccgaggtcgaaagc
gcgctggtgctgcacgaggatgtggcggaggcggcggtcgtcggctttccgcacgacatc
aagggccagggcatttacgcctatgtcacgctcaacgccggggtcgagccgggcgaggac
atcgtcgcggcgctcaaacagcaggtccgcaaggaaatcggtccgatcgcgactcccgac
catatccacctgacccccgcgctgcccaagacacggagcggcaagatcatgcggcggatt
ttgcgcaagattgccgaaaacgacttcggctcgctgggcgacacctcgacgctcgccgat
cccggcctggtcgatgggctgatcgaggagcggcggaatcggtaa

DBGET integrated database retrieval system