KEGG   Sphingopyxis alaskensis: Sala_1811Help
Entry
Sala_1811         CDS       T00361                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sal  Sphingopyxis alaskensis
Pathway
sal00010  Glycolysis / Gluconeogenesis
sal00620  Pyruvate metabolism
sal00640  Propanoate metabolism
sal00680  Methane metabolism
sal01100  Metabolic pathways
sal01110  Biosynthesis of secondary metabolites
sal01120  Microbial metabolism in diverse environments
sal01130  Biosynthesis of antibiotics
sal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sala_1811
   00620 Pyruvate metabolism
    Sala_1811
   00640 Propanoate metabolism
    Sala_1811
  Energy metabolism
   00680 Methane metabolism
    Sala_1811
Enzymes [BR:sal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sala_1811
Lipid biosynthesis proteins [BR:sal01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sala_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABF53523
JGI: Sala1811
UniProt: Q1GS49
Position
1907951..1909915
Genome map
AA seq 654 aa AA seqDB search
MSDLPPSEPMVPVPADAAANTHCSAADYDRLYAASIADPDAFWAEQAKRLDWIKAPTRIA
GWSYDPVSIKWYEDGVLNLCHNAVDRHVAADHGDRTAIIFEPDAPDGETRHISYAALLAD
VVRFANTLKKMGVRKGDRVTIYMPMIPEGAVAMLACARIGAVHSVVFGGFSPEAIHGRIE
DCGSDWVICADEGLRGGKTVPLKANVDKALERIAVRGVLVIAHTGGEVNMTEGRDHWYDA
LSADVSADCPCEPMGAEDPLFILYTSGSTGKPKGVLHTVGGYSVWTATTFWYGFDYRPGE
IFWCSADIGWVTGHSYVVYGPLQNGATTLMFEGVPNYPDHDRFWQVVDKHGVNILYTAPT
AIRALMREGDDYVTRHDLSSLRLLGSVGEPINPEAWRWYHQIVGKGRVPVIDTWWQTETG
GIMITTLPGAHPMQPGSAGRPFFGIRPQLVDADGAVLVDEQTGGAAEGNLCITHSWPGQA
RTVYGDHDRFVQTYFSTYKGKYFTGDGCRRDASGYWRITGRVDDVINVSGHRMGTAEVES
ALVLHEDVAEAAVVGFPHDIKGQGIYAYVTLNAGVEPGEDIVAALKQQVRKEIGPIATPD
HIHLTPALPKTRSGKIMRRILRKIAENDFGSLGDTSTLADPGLVDGLIEERRNR
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacctacccccctccgaacccatggtccccgtccccgccgacgccgccgccaac
acgcattgcagcgctgccgactatgaccgcctctatgccgcgagcatcgccgaccccgac
gccttctgggccgagcaggcgaaacggctcgactggatcaaggcgccgaccaggatcgcg
ggctggtcctatgacccggtgagcatcaaatggtatgaggacggcgttctcaacctctgc
cacaacgccgtcgaccgccatgtcgccgccgaccacggcgaccgcaccgcgatcattttc
gagcccgacgcgcccgacggcgaaacgcggcatatcagctatgccgcgctgctcgccgac
gtcgttcgcttcgcgaacacgctcaagaaaatgggcgtgcggaagggcgaccgcgtcacc
atctatatgccgatgatccccgagggcgcggtggcgatgctcgcctgcgcgcgcatcggc
gcggtgcacagcgtcgtcttcggcggcttctcccccgaagcgatccacggccgtatcgag
gattgcggcagcgactgggtgatctgcgccgacgaggggctgcgcggcggtaagaccgtg
ccgctgaaagccaatgtcgacaaggcgctcgaacgaatcgcggtcaggggtgtgctcgtc
atcgcgcacaccggcggcgaggtgaacatgaccgaagggcgcgaccattggtatgatgcg
ctctcggccgacgtgtccgccgattgcccctgcgagccgatgggcgccgaagacccgctc
ttcatcctctatacctcgggatcgacgggcaagcccaagggtgtgctccacaccgtcggc
ggttacagcgtctggacggcgacgaccttctggtacggtttcgactatcggccgggcgag
attttctggtgcagcgccgacatcggctgggtcaccggccacagctatgtcgtttacggt
ccgctccagaatggcgcgacgaccctgatgttcgagggcgtccccaattatcccgaccat
gaccgcttctggcaggtcgtcgacaagcatggcgtcaacatcctctacaccgcaccgacc
gcaatccgcgcgctgatgcgcgagggcgacgattatgtcacgcggcacgacctgtcgtcg
ctccgcctgctcggcagcgtcggcgagccgatcaacccggaggcgtggcgctggtatcac
cagattgtcggcaagggccgcgtccccgtcatcgacacctggtggcagaccgaaaccggc
gggatcatgatcaccaccttgcccggcgcgcatccgatgcagccgggcagcgcgggacgc
ccctttttcggcatccgtccgcagctcgtcgatgccgatggcgcagtgctcgtcgacgaa
cagaccggcggcgcggcggagggcaatctttgcatcacccacagctggccgggacaggcg
cgcaccgtctatggcgaccatgaccggttcgtgcagacctatttttcgacctacaagggc
aaatatttcaccggcgacggctgccgccgcgacgcgagcggttattggcggattacgggg
cgtgtcgatgacgtgatcaatgtgtcggggcaccgcatgggcaccgccgaggtcgaaagc
gcgctggtgctgcacgaggatgtggcggaggcggcggtcgtcggctttccgcacgacatc
aagggccagggcatttacgcctatgtcacgctcaacgccggggtcgagccgggcgaggac
atcgtcgcggcgctcaaacagcaggtccgcaaggaaatcggtccgatcgcgactcccgac
catatccacctgacccccgcgctgcccaagacacggagcggcaagatcatgcggcggatt
ttgcgcaagattgccgaaaacgacttcggctcgctgggcgacacctcgacgctcgccgat
cccggcctggtcgatgggctgatcgaggagcggcggaatcggtaa

DBGET integrated database retrieval system