KEGG   Sphingopyxis alaskensis: Sala_1911Help
Entry
Sala_1911         CDS       T00361                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sal  Sphingopyxis alaskensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sala_1911
Enzymes [BR:sal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sala_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2009778..2010380)
Genome map
AA seq 200 aa AA seqDB search
MSELGQDLGPDGKLIVPDHVADAVRTLIEWAGDDPAREGLLDTPRRVARAWKEYCSGYGE
DPSIHLSRTFEEVGGYDEVVLLRDIPFQSHCEHHMAPITGKASIAYLPRDRVVGISKLAR
VLNGYARRLQVQERLTAEVAQCIWDNLQPHGVAVVIDAQHGCMTGRGVRTPGVGMVTSRL
LGCFLEDQRSRKEVLGLMGY
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaattgggacaggatttgggaccggacggcaagctgatcgttccggatcatgtc
gcggacgccgtgcgcacgctgatcgaatgggccggcgacgatcctgcgcgcgaaggcctg
ctcgacacgccacgccgcgtcgcgcgcgcgtggaaggaatattgttcgggctatggcgaa
gatccttcgatccacctctcgcgcacctttgaggaggttggcggctatgacgaggtcgtg
ctgctgcgcgacattcccttccagtcgcattgcgaacatcatatggcgccgatcacgggc
aaggcgtcgatcgcctatctgcccagggaccgcgtcgtcggcatttccaagctcgcgcgc
gttctcaatggctatgcgcggcggcttcaggtgcaggagcggctgaccgccgaagtcgcg
cagtgcatctgggacaatctccagccgcacggggtcgcggtggtaatcgacgcgcagcat
ggctgcatgaccggacgcggcgtccgcacgcccggcgtcggcatggtaacgagccgcctg
ctcggctgtttcctcgaagaccagcgcagccggaaggaagtgctgggtttgatgggctat
tga

DBGET integrated database retrieval system