KEGG   Sphingopyxis alaskensis: Sala_1919Help
Entry
Sala_1919         CDS       T00361                                 

Definition
(GenBank) Asparagine synthase, glutamine-hydrolyzing
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sal  Sphingopyxis alaskensis
Pathway
sal00250  Alanine, aspartate and glutamate metabolism
sal01100  Metabolic pathways
sal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sala_1919
Enzymes [BR:sal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Sala_1919
Peptidases [BR:sal01002]
 Cysteine Peptidases
  Family C44
   Sala_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 QueC NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ABF53631
JGI: Sala1919
UniProt: Q1GRU1
Position
complement(2021312..2023207)
Genome map
AA seq 631 aa AA seqDB search
MCGIAGIYHLETAKPVDPARLRAMLQPMQHRGPDGSGEWTAPGVGLAHLRLSIIDIAGSP
QPMASDDEAVTLTYNGEIYNFRELRAELEDRGHRFRTSGDTEVIIAAWRQWGPECLSRLN
GMFAFAIHDHARGCLFLARDRLGVKPLHYARLADGSVAFASELKGLLRHPLLRQEASFSA
VEDFFALGYVPDDNCIVAGIEKLPAGHYLMLERGKGVPAPTCWWAPDFSRRIKASEGEAA
EHLVYLMRAAVTDRMVADVPLGAFLSGGVDSSAVVALMAEASAKAVKTCTIGFDQAALDE
TAYAQQIAERFATDHRTRTVAAGDFALIDRIADMFDEPFADASALPTYRVCELAREEVTV
ALSGDGADEAFAGYRRLVFQHQEEKLRGLIPGFLRRGVLGPLSHVWPQMDWAPRPLRARA
TLASLSKSGAEGYAEAVGVTGPVQRARLFNDAAIRGLGDHVAEGRYWKAMAEAPAREPLD
RAQYADLKIWLPGDILTKTDRMSMAVSLEAREPLLDYRLVEFAASLPASMRVKGGTGKAL
LKQAMERYLPHDILYRPKMGFVTPVSAWFRGALAQQAKALATSSTLARSGWFDMAEIERI
VAAHQSGRRDHGRLIWQFFMLEKSLAKLFGI
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcgcgggcatctatcatcttgagaccgcgaaaccggtcgatccggcgcgg
ctgcgcgcgatgctccagccgatgcagcatcgcggccccgacgggtcgggcgaatggacc
gcgcccggcgtcgggctggcgcacctgcgcctctcgatcatcgacattgcgggcagcccg
cagccgatggcgagcgacgatgaggcggtgacgctcacctacaacggcgaaatctataac
ttccgcgaactgcgcgccgaactcgaggatcgcgggcaccgtttccgcaccagcggcgat
accgaggtcatcatcgcggcgtggcggcaatgggggcccgaatgcctgtcgcggctcaac
ggcatgttcgcctttgcgatccacgaccatgcgcgcggctgcctgttcctcgcgcgcgac
cggctgggggtgaagccgctgcactatgcgcggctggcggacggatcggtggcgttcgcg
tcggaactgaaagggttgctgcgccatcccctgctgcggcaggaagccagtttctccgcg
gtcgaggatttcttcgcgctcggctatgtccccgacgacaattgcatcgttgcggggatc
gagaagctgcccgccgggcattatctgatgctcgaacgcggcaagggcgtgcccgcgccg
acctgctggtgggcgcccgatttttcgcggcggatcaaggcgagcgagggcgaggcggcc
gaacatctggtttatctgatgcgcgccgccgtgaccgaccgcatggtcgccgacgtgccc
ttgggcgcctttctgtcgggcggggtcgattcgagcgcggtcgtcgcgctgatggccgag
gcgagcgcgaaggcggtcaagacctgcacgatcgggttcgaccaagcggcgctcgacgag
acggcctatgcgcagcaaatcgccgagcgcttcgcgaccgatcaccgcacgcgcacggtg
gcggcgggcgatttcgcgctgatcgaccggatcgccgacatgttcgacgaaccctttgcc
gacgcgagcgcgctgccgacgtaccgggtgtgcgagctggcgcgcgaggaggtgacggtg
gctttgtcgggcgacggcgccgacgaggcgtttgcgggctatcggcggctggtgttccag
catcaggaagaaaagctgcgcgggctgatccccggtttcctgcgccgcggtgtgctgggc
ccgctatcgcatgtctggccgcagatggactgggcgccgcgtccgctccgcgcgcgtgca
acgctcgccagcctgtcgaagagcggcgcggagggttatgccgaggcggtcggggtgacg
ggaccggtgcagcgcgcgcggctgttcaacgatgcagcgatccgcgggctgggcgatcat
gtcgccgaggggcgatactggaaggcgatggcggaggcgcccgcgcgcgaaccgctcgac
cgcgcgcaatatgccgacctcaaaatctggctgcccggcgacattttgaccaagaccgac
cggatgagcatggcggtcagcctggaggcgcgcgagcctttgctcgattaccggctcgtc
gagttcgccgcgagcctgcccgcgtcgatgcgggtcaagggcggcacgggcaaggcgcta
ttgaagcaggcgatggaacgctatctgccgcacgacatcctctatcggcccaagatgggg
ttcgtgacgccagtgtcggcctggttccgcggcgcgctcgcccagcaggcgaaggcgctg
gcaacctcgtctacgcttgcccggagcggctggttcgacatggccgagatcgagcggatc
gtcgccgcgcaccagtcgggccgccgcgaccatgggcggttgatctggcaatttttcatg
ctggaaaagtcgctggcgaagctgttcgggatctga

DBGET integrated database retrieval system