KEGG   Sphingopyxis alaskensis: Sala_1935Help
Entry
Sala_1935         CDS       T00361                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sal  Sphingopyxis alaskensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sala_1935
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sala_1935
   00630 Glyoxylate and dicarboxylate metabolism
    Sala_1935
Enzymes [BR:sal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sala_1935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2040111..2042204)
Genome map
AA seq 697 aa AA seqDB search
MTEFLDRSGLSVDSRLADFIEQRALPGTGLDAARFWADFAALLGQFAPENTELLAKREAL
QSQIDAWHRAREGQPHDPAAYQRFLSEIGYLVPEPEPFAIGTANVDPEIATMAGPQLVVP
ALNARFALNAANARWGSLYDALYGTDALDAPPAKPGGYDAERGAAVIARAKAFLDDAVPL
ASGRWADWQGGQLLLADPSQWVGSRTGGILLRHNGLHIELVIDPDGAIGKTDPAGISDVI
LEAALTTIIDLEDSVAAVDGEDKTLGYANWLGLMRGDLTESFEKGGKIVTRAMATDREWT
SPDGEPFTLHGRSVMFVRNVGHLMTTPMIRLPGGAEAPEGLCDAVITSLCSLHDLKGLGA
LRNSRAGSIYIVKPKQHGPEECGFTNRLFDAVEDMLGLARHTIKVGVMDEERRTSANLAA
CIRAVKDRIVFINTGFLDRTGDEIHTSMRAGPMIPKGEMKASDWIAAYEDRNVRIGLACG
LSGKAQIGKGMWAMPDMMRAMLEAKIGHPRSGANTAWVPSPTAATLHALHYHMVDVFARQ
KEIAREAVPSLDRLLTIPVAVGRNWSDAEIARELDNNCQGILGYVVRWIDQGVGCSKVPD
IDDVGLMEDRATLRISSQALANWLLHGVCTPEQVDAALARMAAKVDAQNAGDPLYEKLTP
DSVAYRAARALIFEGVAQPSGYTEPLLHKYRQMKKAG
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatttctcgaccgctcgggcctgtccgtcgattcgcggctggccgatttcatc
gagcagcgcgcgctgcccggcacggggctggacgccgcgcgcttctgggccgatttcgct
gctctgctgggccagtttgcgccggaaaatacggagctgctggcgaagcgcgaggcgttg
cagtcgcagatcgacgcctggcatcgggcccgcgaaggccagccgcacgatcccgccgct
tatcagcgcttcctgtccgagatcggctatctcgtccccgaacccgagccgtttgcgatc
ggcacggcgaatgtcgatccggaaatcgcaacaatggccgggccgcagctcgtcgtgccc
gccctcaacgcacgctttgccctgaacgccgccaacgcgcgctggggcagcctctatgac
gcgctttacggtaccgacgcactcgacgcgccgcctgcgaagcccggcggctatgatgcg
gaacgcggcgcggcggtgatcgcgcgcgccaaggcctttctggacgacgcggtgccgctg
gcgtcgggtcgctgggccgactggcagggcggacagcttttgcttgccgatccgtcgcaa
tgggtcggcagcagaaccggcggtattctgctccgccacaatggcctgcacatcgagctg
gtgatcgaccccgacggcgcgatcggcaagaccgacccggcggggatttccgatgtcatc
ctcgaagccgcgctgaccaccatcatcgaccttgaggacagcgtcgcggcggtcgatggc
gaggacaagacgctcggctatgcgaactggctggggctgatgcgcggcgacctcaccgaa
agtttcgaaaagggcggcaagatcgtcacgcgcgccatggcgaccgaccgcgaatggacg
tcgcccgacggcgagccgttcacgctccacggccgcagtgtgatgttcgtgcgaaatgtc
ggccatctgatgacgacgccgatgatccggctgcccggtggcgccgaagcgcccgaaggg
ctgtgcgatgcggtcatcaccagcctgtgctcgctccacgatctgaagggcctcggcgcc
ctcaggaacagtcgcgcgggcagcatctatatcgtcaagcccaagcagcacgggcccgag
gaatgcggcttcacgaaccggctgttcgacgcggtcgaggacatgctggggctggcgcgc
cacacgatcaaggtcggggtgatggacgaggaacgtcgcaccagcgcgaaccttgccgcc
tgcatccgcgcggtgaaggaccgcatcgtctttatcaacaccggctttctcgaccgcacc
ggcgacgagattcacacgtcgatgcgcgcgggaccgatgattccgaagggcgagatgaag
gcgtcggactggatcgccgcctatgaggatcgcaacgtccgcatcgggctcgcctgcggc
ctgtcgggcaaggcgcagatcggcaagggcatgtgggcgatgcccgacatgatgcgggcg
atgctcgaggcgaaaatcggccaccccagatcgggcgcgaacaccgcctgggttccctcg
ccgaccgcggcgacgctgcatgcgctgcattatcatatggtcgatgtgtttgcgcggcag
aaggagatcgcgcgcgaggcggtgccgtcgctggaccgcctgctcaccattcccgtcgcc
gtggggcgcaattggagcgacgccgaaatcgcgcgcgaactcgacaataattgccagggc
atattgggctatgtcgtacgctggatcgaccagggcgtcggctgttccaaggtgcccgac
atcgacgacgtcggcctgatggaggatcgcgcgacgctgcggatcagcagccaggcgctc
gccaactggctcctccacggcgtctgcacgcccgaacaggtcgacgccgcgctggcgcgg
atggcggcgaaggtcgatgcccagaatgcgggcgacccgctgtacgaaaagctgacgccc
gatagcgtcgcgtatcgggcagcgcgcgcgctgatcttcgaaggcgtggcgcagccgtcg
ggctacaccgaaccgctgctgcacaaatatcggcagatgaagaaggcggggtga

DBGET integrated database retrieval system