KEGG   Sphingopyxis alaskensis: Sala_1948Help
Entry
Sala_1948         CDS       T00361                                 

Definition
carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sal  Sphingopyxis alaskensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sal00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2054275..2055747
Genome map
AA seq 490 aa AA seqDB search
MAEMIIVIDEGTTSTRTMLFAADGTPLGSAQREIRQHYPGPGLVEHDAAEIWEATLACTR
EMVARAGGADHVAAIGITNQRETIVFWDRATNEPLAPAIVWQDRRTSADCAALKEAGHET
AVQATSGLLLDPYFSGSKIGWALRHWPQLKDAGARLAVGTIESWLVYRLTGGVHVTDATN
ASRTALMAIEGEGGWNAGLCDLFGVPMRLLPEITGCTTVVGTTDPALFGGAIAIAGIAGD
QQAATIGQACLSPGQTKATFGTGAFILSASGATRRHSSNRLLATVLVQEGDARVYALEGS
VFVAGSLIKWLRDGLGLLASASESEGLARAVPDNGGVYLVPALSGLGAPHWRPDALAALS
GLSFASTKAHVARAALEAQSYQAHDLKSAFAADGVDWAELRIDGGMAANDWMAQDLADML
DLTVERPDFVESTALGAAMLAATGAGIYPDLKTAAQAMRGTATRFTPALDATQRKTRLAG
WQSALAKVLG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaatgatcattgtcatcgacgaaggcacgacctccacccgcaccatgctgttt
gccgccgacgggacgccgctcggcagcgcgcagcgcgagataaggcagcactatccgggt
cccggcctcgtcgagcatgacgccgccgagatctgggaagcgacgcttgcctgcacgcgc
gaaatggtggcgcgcgccggtggcgcggatcatgtggcggcgatcggcatcaccaaccag
cgtgaaacgatcgtcttctgggatcgcgcaaccaacgaaccgcttgcgcctgcgatcgtg
tggcaggaccggcgcacctcggccgactgtgccgcgctgaaggaggcggggcatgagact
gcggtgcaggcgaccagcggattgctgctcgacccctatttttcgggaagcaagatcggc
tgggcgcttcggcactggccgcaactgaaggacgcgggagcgcggctcgccgtgggaacg
atcgaatcatggctcgtttatcgcctgaccggcggcgtgcatgtcaccgacgcgaccaat
gcgtcgcgcacggcattgatggccatcgagggcgagggaggctggaacgccgggctttgc
gacctgtttggcgtaccgatgcggctgctgcccgaaatcaccggctgtaccacggtcgtc
ggcacgaccgacccggcgctgttcggcggcgcgatcgcgatcgccggcatcgcgggcgac
cagcaggccgcaacgatcggccaggcgtgcctttcaccggggcagaccaaggctaccttc
ggcactggcgccttcatcctgtcggcgagcggcgcgacgcgacggcattcgtcgaatcgc
ctgctcgcgacggtgctggtgcaggaaggcgacgcccgcgtctatgcgctcgaagggtcg
gtcttcgttgccggcagcctgatcaaatggctgcgcgacggattgggcctgctcgcaagc
gcgagcgaaagcgagggactggcacgggcggtacccgataatggcggcgtctacctggtc
cccgccctgtcgggactgggagcgccgcactggcggcctgacgcgctcgcggcgctttcg
ggcctcagttttgccagcacgaaggcgcatgtcgcgcgcgctgcgctggaggcgcagtcc
tatcaggcgcatgatcttaaatcggccttcgccgccgacggggtcgactgggccgaattg
cgtatcgatggcggcatggcggcgaatgactggatggcgcaggacctggccgacatgctg
gatctgaccgtcgagcgacccgatttcgtcgaaagcaccgcgcttggcgccgcaatgctc
gctgcaaccggcgcagggatttaccccgacctcaagaccgcggcgcaggcgatgcgcggc
accgcgacccgcttcacgccggcgctggatgccacgcaacgcaaaacgcgccttgccggg
tggcaaagcgcgcttgcaaaggttctgggataa

DBGET integrated database retrieval system