KEGG   Sphingopyxis alaskensis: Sala_2227Help
Entry
Sala_2227         CDS       T00361                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sal  Sphingopyxis alaskensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sala_2227
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sala_2227
  Amino acid metabolism
   00310 Lysine degradation
    Sala_2227
Enzymes [BR:sal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sala_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2338186..2339400)
Genome map
AA seq 404 aa AA seqDB search
MSTEVKVPTLGESVTEATIGEWLKKPGEAVALDEPIASLETDKVAVEVPSPVAGVMGQQL
AAVGDTVNVGAVIATVEAGDAAAAPAPAKAETTAPAPAATAPAAGAGIDTVATMSPAVRR
LVLEHGLDPTKIKGTGKDGRLTKEDVLAAANAAPETPPASAPAPAAAPAEPGRQEERVKM
TRLRQTIAKRLKAAQDTAAMLTTFNDVDMSAVIEARARYKDLFEKKHGVRLGFMGFFTKA
ACLALKDIPAVNGRIDGDEIVYNGYMDISVAVSGPSGLVVPVIRNAETLSFADIEKTIGD
FGKRAKEGTLTMDDMAGGTFTISNGGVFGSLMSTPIINPPQSAVLGLHRIEDRPVAINGQ
VVIRPMMYLALSYDHRLIDGREAVTFLKTIKEAIEDPTRLLIDL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaagtcaaagtccccacgctgggcgaaagcgtcaccgaagcgacgatcggc
gaatggctgaaaaagcccggcgaagcggtcgcgctcgacgagcccatcgccagccttgaa
accgacaaggtcgcggtcgaggtgccctcgcccgtcgcgggggtgatggggcagcagctc
gctgcggtcggcgacacggtcaatgtcggtgcggtgatcgcgacggttgaagcgggcgat
gcggcggcggcgcccgcccccgcgaaggccgagacgacggcgcccgcccccgccgcgacc
gcccccgccgcgggtgcaggcatcgacaccgttgcaaccatgtcgccggcggtgcgccgt
ctcgtcctcgaacacgggctcgatccgacgaagatcaaggggacggggaaggacggtcgg
ctgaccaaggaagatgtgctcgcggcggcgaatgcggcgcccgaaaccccgcctgcttcg
gctcccgcgccggcggcagcgcccgccgagccgggccgtcaggaagagcgcgtcaagatg
acccgcctgcgccagacgatcgccaagcggctgaaagcggcgcaggacacggcggcgatg
ctgacgaccttcaacgacgtcgacatgtcggcggtgatcgaagcgcgcgcgcgctacaag
gatctgttcgaaaagaagcatggcgtgcggctgggcttcatgggcttcttcaccaaggcg
gcgtgcctcgcgctcaaggacattcccgcggtcaacggccgcatcgacggcgacgagatc
gtctataatggttatatggacatttcggtcgcggtgagcgggccgagcgggcttgtcgtg
ccggtgatccgcaatgccgagacgctgagcttcgccgacatcgaaaagacgatcggtgat
ttcggcaagcgcgccaaggagggcacgctgaccatggacgacatggcgggcggcaccttt
accatttcgaacggcggcgtgttcgggtcgctgatgtcgaccccgatcatcaacccgccg
cagtcggcggtgctcggcctccaccgcatcgaggaccgtccggtcgcgatcaatggtcag
gtcgtgatccgtccgatgatgtatctggcgctcagctatgaccaccgcctgatcgacggc
cgcgaggcggtgaccttcctcaagacgatcaaggaagcgatcgaagatccgacgcggttg
ctgatcgatttgtaa

DBGET integrated database retrieval system