KEGG   Sphingopyxis alaskensis: Sala_2455Help
Entry
Sala_2455         CDS       T00361                                 

Definition
alcohol dehydrogenase GroES-like protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sal  Sphingopyxis alaskensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sala_2455
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sala_2455
  Lipid metabolism
   00071 Fatty acid degradation
    Sala_2455
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sala_2455
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sala_2455
   00626 Naphthalene degradation
    Sala_2455
Enzymes [BR:sal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sala_2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2596523..2597548
Genome map
AA seq 341 aa AA seqDB search
MAKTMKAAVVREFGKPLVIEEAPIPTVGPGQILVKVAAAGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVAAVGSGVTLIKEGDRVGVPWLYSACGHCVHCLGGWETLCESQQNTGYSV
NGSFAEYVLADPNYVGHLPDNVDFLDIAPILCAGVTVYKGLKATEAKPGEWVVVSGIGGL
GHMAVQYARAMGLNVAAVDVDDRKLDLATRLGAALTVNAREEDPSAAIKQAIDGAQGVLV
TAVSPKAFQQALGMVRRGGTVALNGLPPGDFPLSIFDTVLNGITVRGSIVGTRLDLLEAL
AFAGEGKVHATVHAEKLENINDVFARMRRGDIDGRIVLDLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaccatgaaggcggcggtcgtccgcgaattcggtaagccgctggtcatcgaa
gaagcgccgatcccgacggtcggacccggccagatcctggtaaaggtcgcggcggccggc
gtatgccacaccgacctgcatgcggccgagggcgactggccggtcaagcccaacccgccc
ttcattcccgggcatgaaggcgtcggacatgtcgccgccgtcggatcgggcgtcactctc
ataaaagagggcgaccgggtcggcgtcccctggctctactccgcctgcgggcattgcgtg
cattgcctgggcggctgggagacgttgtgcgagagccagcagaataccggctattcggtg
aatggcagcttcgcggaatatgtcctcgccgatccaaattatgtcgggcatcttcccgac
aatgtcgacttcctcgacatcgcgccgatcctctgcgccggcgtcaccgtctataaaggg
ctgaaggccaccgaggcgaagcccggagagtgggtggtcgtctccgggatcggcgggctc
ggccacatggcggtgcaatatgcccgcgcgatgggtctcaatgtggcggcggtcgacgtc
gacgaccgcaagctcgatctcgcgacccgtctcggcgcggcgctcacggtcaacgcgcgc
gaggaggatccgtcagccgccatcaagcaggcgatcgacggtgcgcagggcgtcctcgtc
accgcggtctcgcccaaggccttccagcaggcgctcggcatggtccggcgcggtggtacg
gtcgcgctcaacggccttccaccgggcgattttccgctgtcgatcttcgacaccgtactc
aacggcatcaccgttcgcggttcgatcgtcggcacccggctcgaccttctcgaagcactg
gccttcgccggcgaaggcaaggtgcatgcgacggtgcacgccgaaaagctggagaacatc
aacgacgtctttgcgcgcatgcgccgcggcgacattgacgggcggatcgttctcgatctg
gcctga

DBGET integrated database retrieval system