KEGG   Sphingopyxis alaskensis: Sala_2829Help
Entry
Sala_2829         CDS       T00361                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sal  Sphingopyxis alaskensis
Pathway
sal00010  Glycolysis / Gluconeogenesis
sal00260  Glycine, serine and threonine metabolism
sal00680  Methane metabolism
sal01100  Metabolic pathways
sal01110  Biosynthesis of secondary metabolites
sal01120  Microbial metabolism in diverse environments
sal01130  Biosynthesis of antibiotics
sal01200  Carbon metabolism
sal01230  Biosynthesis of amino acids
Module
sal_M00002  Glycolysis, core module involving three-carbon compounds
sal_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sala_2829
  Energy metabolism
   00680 Methane metabolism
    Sala_2829
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sala_2829
Enzymes [BR:sal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Sala_2829
Membrane trafficking [BR:sal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Sala_2829
Exosome [BR:sal04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Sala_2829
  Exosomal proteins of melanoma cells
   Sala_2829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABF54534
JGI: Sala2829
UniProt: Q1GP88
Position
complement(2985157..2985843)
Genome map
AA seq 228 aa AA seqDB search
MPQLILIRHGQSQWNLENRFTGWWDVDVTEKGAAEAWAAGELMKAKGVAPDTCFTSVQTR
AIKTLNLALEAMGRLWLPVTKDWRLNERHYGGLTGLDKAETAAKHGDEQVRIWRRSFDIP
PPPLEAGSQWDLSADPRYAGIAIPSTESLKDTIARVLPYYEAAIAPQLAAGRTVLISAHG
NSLRALVKHLSGISDADITGLEIPTGQPIVYEINDDLSARERYYLSER
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctcatcctcatccgtcatggccagtcgcagtggaatctcgaaaaccgcttc
accggctggtgggatgtcgatgtcaccgaaaagggtgcggccgaagcctgggcggcgggc
gaactgatgaaggcgaagggcgtcgcgcccgacacctgtttcacctccgtccagacgcgc
gcgatcaagacattgaacctcgcgctcgaggcaatgggccgcctgtggctgccggtgacg
aaggactggcggctcaacgaacgccactatggcgggctcaccgggctcgacaaggccgag
accgcggccaagcatggtgacgagcaggtcaggatatggcgccgcagcttcgacatcccg
ccgccgccgctcgaagccgggtcgcaatgggatctgtccgccgacccgcgttacgccggc
atcgcgattccgtcgaccgaaagcctgaaggacacgatcgcgcgcgtgcttccctattat
gaagccgcgatcgcgccgcagcttgccgcgggcagaacggtgctgatctcggcgcacggc
aacagcctgcgcgcgctcgtcaagcatctgtcgggcatttcggacgccgacatcaccggc
ctcgaaatcccgaccggccagccgatcgtttatgaaatcaacgacgatctgagcgcgcgc
gagcgctattatctcagcgagcggtaa

DBGET integrated database retrieval system