KEGG   Sphingopyxis alaskensis: Sala_3031Help
Entry
Sala_3031         CDS       T00361                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sal  Sphingopyxis alaskensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sala_3031
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sala_3031
   00650 Butanoate metabolism
    Sala_3031
  Energy metabolism
   00190 Oxidative phosphorylation
    Sala_3031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3177636..3178040
Genome map
AA seq 134 aa AA seqDB search
MGNGTRLGRVRGLGSSHHGSHHWLQQRLTALGNILLVSFLFVSLLRLPLADHGAVLRWAS
NPSVALALILMVISVFWHLRLGLQVMIEDYIHGEATRLFALVLLNFYAIGGAAYGIFAIV
RIALAPAALGPGGM
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgggtaatggaacgcgcctcggtcgcgtgcgcgggctcggctcgtcgcatcacggatcg
catcactggctgcaacagcggctgaccgcgctcggcaacatcctgctcgtctctttcctc
ttcgtctcgctgctgcgcctgccgctcgccgatcatggcgcggtgctgcgctgggcgtcg
aacccctcggtcgcgctggcgctgatcctgatggtcatcagcgttttctggcacctgcgg
ctggggttgcaggtgatgatcgaggattacatccatggcgaagcaacgcggctgttcgcg
ctcgtcctgttgaacttctacgcgatcggcggcgccgcctatggcattttcgcgatcgtg
cgcatcgcgctggcgcccgcggcgctcggccccgggggcatgtaa

DBGET integrated database retrieval system