KEGG   Streptomyces albus J1074: XNR_0333Help
Entry
XNR_0333          CDS       T02545                                 

Definition
(RefSeq) DNA polymerase LigD, polymerase domain-containing protein
Organism
salb  Streptomyces albus J1074
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(403297..404316)
Genome map
AA seq 339 aa AA seqDB search
MGSEAVQLEVDGHSVRLSHPDKVWFPERGFTKLDVAQYFLAVQGGVTRALRRRPTTLQRF
PDGVDGEFFYQKRAPKNKPDWLDTARISFPSGRHADEICPDSPAAVLWAVNLGCLTFHPW
PVRAPDTEHPDELRVDLDPQPGTDFRDAVAAAQTLREILDEYGLRGWPKTSGGRGLHVFI
PIEPVEPFVEVRRAAIALAREIERRMPERVTTAWWKEERGERIFVDYNQTARDRTIAGAY
SVRGKPHAPVSAPLRWDELDDADPRDFDLLTMQARYAALGDVHADIDDHAYRLDPLLELA
ARDAAEHGLEDLPYPPDHPKMPGEPRRVQPSRARRDSGD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgggatcggaagcggtgcaactcgaggtcgacgggcacagcgtgcggctctcccacccg
gacaaggtgtggttccccgagcgcggcttcaccaagctggacgtcgcccagtacttcctc
gccgtccagggcggcgtcacccgcgccctgcgccggcggcccaccaccctccagcgcttc
cccgacggcgtggacggcgagttcttctaccagaagcgcgcgccgaagaacaagcccgac
tggctcgacaccgcccgcatctccttccccagcggccgccacgccgacgagatctgcccc
gactccccggccgccgtcctgtgggccgtcaacctcggctgcctcaccttccacccctgg
ccggtgcgggccccggacaccgagcaccccgacgagctgcgcgtcgacctcgacccgcag
cccggcacggacttccgcgacgccgtcgccgccgcccagaccctgcgcgagatcctcgac
gagtacggcctgcgcggctggcccaagacctccggcgggcgaggcctgcacgtcttcatc
ccgatcgagccggtcgagcccttcgtggaggtccgcagggccgccatcgcgctggcccgc
gagatcgagcgccgtatgcccgagcgggtcaccacggcctggtggaaggaggagcgcggc
gagcgcatcttcgtcgactacaaccagaccgcccgcgaccgcaccatcgccggtgcctac
tccgtccgcggcaagccccacgccccggtctccgccccgctgcgctgggacgaactggac
gacgccgacccccgcgacttcgacctcctcaccatgcaggcccgctacgccgccctcggc
gacgtgcacgccgacatcgacgaccacgcctaccgcctcgaccccctcctggaactggcc
gcccgcgacgcggccgaacacggcctggaggacctgccctacccgccggaccaccccaag
atgccgggcgaaccccgccgcgtacagccgagcagggcccgccgcgactccggagactga

DBGET integrated database retrieval system