KEGG   Streptomyces albus: XNR_0573Help
Entry
XNR_0573          CDS       T02545                                 

Definition
dTDP-4-keto-6-deoxyhexose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
salb  Streptomyces albus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    XNR_0573
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XNR_0573
Enzymes [BR:salb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     XNR_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(674513..675175)
Genome map
AA seq 220 aa AA seqDB search
MSPPDTAAGGTPEGAPPGPVVNAGAVRTLRVSGAFVFTPQVFHDDRGMFVDSYQLPVFAE
TAGRPFPLFQASHSRSRRGVVRGVHFTSAPPGMAKYVHCAAGRALDLVVDLRVGSPTFGR
WDSVVLDAARPRSTYLPVGVGHAFVALEDDTMMTYLMSGGYVPRDEHAVSPLDPALDLPF
PLDGDPVLSARDRQAPTLAEAGRQGLLPEYETCLALDRVL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgagccccccggacacggcggccggcgggacccccgagggcgccccgccggggccggtg
gtgaatgccggagccgtccgcacgctcagggtgagcggggcgttcgtgttcacgccccag
gtcttccacgacgaccggggcatgttcgtcgactcctaccaactgccggtcttcgccgag
accgccgggaggcccttcccgctcttccaggccagccacagccgctcgcggcgcggcgtg
gtccgcggagtgcacttcacctcggcgccccccggcatggccaagtacgtgcactgcgcc
gccgggagagcgctcgacctcgtcgtggacctccgcgtcgggtcaccgaccttcggccgg
tgggactcggtggtgctcgacgcggcgcgcccgcggtcgacgtatctgccggtcggcgtc
ggtcacgcattcgtggcgctggaggacgacacgatgatgacgtacctgatgtccggcggg
tacgtcccccgcgacgaacacgccgtctctccgctggaccccgcgctggatctgcccttt
ccactcgacggcgacccggtgctgtcagcgcgcgaccggcaggcccccaccctggccgag
gccgggcggcaaggactgctgccggagtacgagacctgcctggcgctcgaccgggtgctc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system