KEGG   Streptomyces albus J1074: XNR_0573Help
Entry
XNR_0573          CDS       T02545                                 

Definition
(RefSeq) dTDP-4-keto-6-deoxyhexose 3,5-epimerase
  KO
K16438  
epimerase EvaD
Organism
salb  Streptomyces albus J1074
Pathway
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    XNR_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(674513..675175)
Genome map
AA seq 220 aa AA seqDB search
MSPPDTAAGGTPEGAPPGPVVNAGAVRTLRVSGAFVFTPQVFHDDRGMFVDSYQLPVFAE
TAGRPFPLFQASHSRSRRGVVRGVHFTSAPPGMAKYVHCAAGRALDLVVDLRVGSPTFGR
WDSVVLDAARPRSTYLPVGVGHAFVALEDDTMMTYLMSGGYVPRDEHAVSPLDPALDLPF
PLDGDPVLSARDRQAPTLAEAGRQGLLPEYETCLALDRVL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgagccccccggacacggcggccggcgggacccccgagggcgccccgccggggccggtg
gtgaatgccggagccgtccgcacgctcagggtgagcggggcgttcgtgttcacgccccag
gtcttccacgacgaccggggcatgttcgtcgactcctaccaactgccggtcttcgccgag
accgccgggaggcccttcccgctcttccaggccagccacagccgctcgcggcgcggcgtg
gtccgcggagtgcacttcacctcggcgccccccggcatggccaagtacgtgcactgcgcc
gccgggagagcgctcgacctcgtcgtggacctccgcgtcgggtcaccgaccttcggccgg
tgggactcggtggtgctcgacgcggcgcgcccgcggtcgacgtatctgccggtcggcgtc
ggtcacgcattcgtggcgctggaggacgacacgatgatgacgtacctgatgtccggcggg
tacgtcccccgcgacgaacacgccgtctctccgctggaccccgcgctggatctgcccttt
ccactcgacggcgacccggtgctgtcagcgcgcgaccggcaggcccccaccctggccgag
gccgggcggcaaggactgctgccggagtacgagacctgcctggcgctcgaccgggtgctc
tga

DBGET integrated database retrieval system